KEGG   Pongo abelii (Sumatran orangutan): 100174401Help
Entry
100174401         CDS       T01416                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100174401 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100174401 (SLC4A1)
   04147 Exosome [BR:pon04147]
    100174401 (SLC4A1)
   04090 CD molecules [BR:pon04090]
    100174401 (SLC4A1)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100174401 (SLC4A1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100174401 (SLC4A1)
CD molecules [BR:pon04090]
 Proteins
  100174401 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 100174401
NCBI-ProteinID: NP_001127339
Ensembl: ENSPPYG00000008336
UniProt: Q5RBP3
Position
17
AA seq 852 aa AA seqDB search
MDEKNQELRWMEAARWVRLEENLGENGAWGRPHLSHLTFWSLLELHKVFTKGTVLLDLQE
TSLAGVANQLLDRFIFEDQIRPQDRDELLRALLLKHSHAGELEALGGVKPAVLTRSGDPS
QPLLPQHSSLETQLFCEQGDGGTEGHLPSGILEKIPPDSEATLVLVGRAIFLEEPVLGFV
RLQEAAELEAVELPVPVRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRVEAFVAQSRA
ELLRSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQPSPAKPDSTFYKGLDSN
GGLGGPGGPDDPLQQTGQFFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSP
AITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFC
ESNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSK
LIKIFQDHPLQKTYDHNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPG
KLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARSWVIHPLGLRSHF
PIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALF
GMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPI
LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGI
QIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPCIFRNLELQCLDADDAKATFDEEE
GRDEYDEVAMPV
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaagaaccaggagctgagatggatggaggcggcgcgctgggtgcgactggag
gagaacctgggggagaacggggcctggggccgcccgcacctctctcacctcaccttctgg
agcctcctagagctgcataaagtcttcaccaagggtactgtcctcctagacctgcaagag
acctccctggctggagtggccaaccaactgctagacaggtttatctttgaagaccagatc
cggcctcaggaccgagacgagctgctccgggccttgctgctcaaacacagccatgccgga
gagctggaggccctggggggtgtgaagcctgcagtcctgacacgctctggggatccttca
cagcctctgctcccccaacactcctcactggagacacagctcttctgtgagcagggagat
gggggcacagaagggcacttaccatctggaattctagaaaagattcccccggattcagag
gccacgctggtgctagtgggccgcgccatcttcctggaggagccggtgctgggctttgtg
aggctgcaggaggcagcggagctggaggcggtggagctgccggtgcctgtgcgcttcctc
tttgtgttgctgggacctgaggccccccacatcgattacacccagcttggccgggccgct
gccacacttatgtcagagagggtgttccgcgtagaggccttcgtggctcagagccgagcg
gagctgctgcgctccctggagggcttcctggactgcagcctagtgctgcctcccaccgat
gccccctctgagcaggcactgctcagtctggtgcctgtgcagagggagctacttcgaagg
cgctatcagcccagccctgccaagccagactccaccttctacaagggcctagactcaaat
gggggcctagggggccccgggggcccagacgaccctctgcagcagacaggccagttcttc
gggggcctggtgcgtgacatccggcgccgctacccctattacctgagtgacatcacagat
gcattcagcccccaggtcctggctgctgtcatcttcatctactttgctgccttgtcaccc
gccatcaccttcggcggcctcctgggagaaaagacccggaaccagatgggagtgtcggag
ctgctgatctccactgcagtgcagggcattctcttcgccctgctgggggctcagcccctg
cttgtggtcggcttctcaggacccctgctggtgtttgaggaagccttcttctcgttctgc
gagagcaacggtctagagtacatcgtgggccgtgtgtggatcggcttctggctcatcctg
ctggtggtgttggtggtggcctttgagggtagcttcctggtccgcttcatctcccgctat
acccaggagatcttctccttcctcatttccctcatcttcatctacgagaccttctccaag
ctgatcaagatcttccaggaccacccactacagaagacttatgaccacaacgtgttgatg
gtgcccaaacctcagggccccctgcccaacacagccctcctctcccttgtgctcatggcc
ggtaccttcttctttgccatgatgctgcgcaagttcaagaacagctcctacttccctggc
aagctgcgtcgggtcatcggggacttcggggtccccatctccatcctgatcatggtcctg
gtggatttcttcattcaggatacctacacccagaaactctcggtgcccgatggcttcaag
gtgtccaactcctcagcccggagctgggtcatccacccactgggcttgcgttcccacttt
cccatctggatgatgtttgcctctgccctgcctgctctgctggtgttcatcctcatattc
ctggagtctcagatcaccacgctgattgtcagcaaacccgagcgcaaaatggtcaagggc
tccggcttccacctggacctgctgctggtagtaggcatgggtggggtggccgcccttttt
gggatgccctggctcagtgccaccaccgtgcgttccgtcacccatgccaacgccctcact
gtcatgggcaaagccagcaccccaggggctgcagcccagatccaggaggtcaaagagcag
cggatcagcggactcctggtcgctgtgcttgtgggcctgtccatcctcatggagcccatc
ctgtcccgcatccccctggctgtactgtttggcatcttcctctacatgggggtcacatcg
ctcagcggcatccagctctttgaccgcatcttgcttctgttcaagccacccaagtatcac
ccagatgtgccctacgtcaagcgggtgaagacctggcgcatgcacttgttcacgggcatc
cagatcatctgcctggcagtgctgtgggtggtgaagtccacgccggcctccctggccctg
ccctttgtcctcatcctcactgtgccgctgcggcgcgtcctgctgccgtgcatcttcagg
aacctggagcttcagtgtctggatgctgacgatgccaaggcaacctttgatgaggaggaa
ggtcgggatgaatacgatgaagtggccatgcctgtgtga

DBGET integrated database retrieval system