KEGG   Pongo abelii (Sumatran orangutan): 100174423Help
Entry
100174423         CDS       T01416                                 

Gene name
RPP14
Definition
(RefSeq) ribonuclease P protein subunit p14
  KO
K14529  ribonuclease P protein subunit RPP14 [EC:3.1.26.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100174423 (RPP14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pon03016]
    100174423 (RPP14)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100174423 (RPP14)
Transfer RNA biogenesis [BR:pon03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100174423 (RPP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_P_Rpp14
Motif
Other DBs
NCBI-GeneID: 100174423
NCBI-ProteinID: NP_001127358
Ensembl: ENSPPYG00000013762
UniProt: Q5RB79 A0A2J8T1B4
Position
3
AA seq 124 aa AA seqDB search
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALP
LDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRE
LVLD
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccctgctgccacatatgaaagagtagtttacaaaaacccttccgagtaccac
tacatgaaagtctgcctagaatttcaagattgtggagttggactgaatgctgcacagttc
aaacagctgcttatttctgctgtgaaggacctgtttggggaggttgatgccgccttacct
ttggacatcctaacctatgaagagaagaccttgtcagctatcttgagaatatgtagcagt
ggtcttgtcaaattgtggagctctttgaccctgttaggatcctataaaggcaaaaaatgt
gctttccgggtgattcaggtttctccatttctccttgcgttatctggtaatagtagggaa
ctagtattggattga

DBGET integrated database retrieval system