KEGG   Pongo abelii (Sumatran orangutan): 100294540Help
Entry
100294540         CDS       T01416                                 

Gene name
PLK4
Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100294540 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100294540 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100294540 (PLK4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100294540 (PLK4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100294540 (PLK4)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100294540 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     100294540 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    100294540 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like DUF4520
Motif
Other DBs
NCBI-GeneID: 100294540
NCBI-ProteinID: NP_001153257
Ensembl: ENSPPYG00000015057
UniProt: Q5R9Z7
Position
4
AA seq 970 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPTFLSMEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSQNSSTKSKDLGTVEDSIDSGHATLSTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSSDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTFNSPSQAKTYTMERCHSAEMLSMSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQTLSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPTRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQP
NTMKYMTALHSKPEIVQQECVFGSDPLSEQSKTRGMEPPLGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELLKEYASQEYVKEVLQISSDGNMITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRDRASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTYISSNSLKDCLPKSVQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPEYIKQKLQCLSSILL
MFSNPTPNFH
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggggagaagatcgaggattttaaagttggaaatctgcttggtaaa
ggatcatttgctggtgtctacagagctgagtccattcacactggtttggaagttgcaatc
aaaatgatagataagaaagccatgtacaaagcaggaatggtacagagagtccaaaatgag
gtgaaaatacattgccaattgaaacatccttctatcttggagctttataactattttgaa
gatagcaattatgtgtatctggtattagaaatgtgccataatggagaaatgaacaggtat
ctgaagaatagagtgaaacccttctcagaaaatgaagctcgacacttcatgcaccagatc
atcacagggatgttgtatcttcattctcatggtatactacaccgggacctcacactttct
aacctcctactgactcgtaatatgaacatcaagattgctgattttgggctggcaactcaa
ctgaaaatgccacatgaaaagcactatacattatgtggaactcctaactacatttcacca
gaaattgccactcgaagtgcacatggccttgaatctgatgtttggtccctgggctgtatg
ttttatacattacttatcgggagaccaccctttgacactgacacagtcaagaacacatta
aataaagtagtattggcagattatgaaatgccaacttttttgtcaatggaggccaaggac
cttattcaccagttacttcgtagaaatccagcagatcgtttaagtctgtcttcagtattg
gaccatccttttatgtcccaaaattcttcaacaaaaagtaaagatttaggaactgtggaa
gactcaattgatagtgggcatgccacactttctactgcgattacagcttcttccagtacc
agtataagtggtagtttatttgacaaaagaagacttttgattggtcagccactcccaaat
aaaatgactgtatttccaaagaataaaagttcaagtgatttttcttcttcaggagatgga
aacagtttttatactcagtggggaaatcaagaaaccagtaatagtggaaggggaagagta
attcaagatgcagaagaaaggccacattctcgataccttcgtagagcttattcctctgat
agatctggcacttttaatagtccatctcaagcaaaaacatatacaatggaacgatgtcac
tcagcagaaatgctttcaatgtccaaaagatcaggaggaggtgaaaatgaagagaggtac
tcacccacagacaacaatgccaacatttttaacttctttaaagaaaagacatccagtagt
tctggatcttttgaaagacctgataacaatcaaacactctccaatcatctttgtccagga
aaaactccttttccatttgcagacccgacacctcagactgaaacggtacaacagtggttt
gggaatctgcaaataaatgctcatttaagaaaaactactgaatatgacagtatcagccca
actcgggatttccagggccatccagatttgcagaaggacacatcaaaaaatgcctggact
gatacaaaagtcaaaaagaactctgatgcttctgataatgcacattctgtaaaacagcca
aataccatgaaatatatgactgcacttcacagtaaacctgagatagtccaacaagaatgt
gtttttggctcagatcctctttctgaacagagcaagactaggggtatggagccaccattg
ggttatcagaatcgtacattaagaagcattacgtctccgttggttgctcacaggttgaaa
ccaatcagacagaaaaccaaaaaggctgtggtgagcatacttgattcagaggaggtgtgt
gtggagcttctaaaggagtatgcatctcaagaatatgtgaaagaagttcttcagatatct
agtgatggaaatatgatcactatttattatccaaatggtggaagaggttttcctcttgct
gatagaccaccctcacctactgacaacatcagtaggtacagctttgacaatttaccagaa
aaatactggcgaaaatatcaatatgcttccaggtttgtacagcttgtaagatctaaatct
cccaaaatcacttattttacaagatatgctaaatgcattttgatggagaattctcctggt
gctgattttgaggtttggttttatgatggggtaaaaatacacaaaacagaagatttcatt
caggtgattgaaaagacagggaagtcttacactttaaaaagtgaaagtgaagttaatagc
ttgaaagaggagataaaaatgtatatggaccatgctaatgagggtcatcgtatttgttta
gcactggaatccataatttcagaagaggaaaggaaaactaggagtgctccctttttccca
ataatcataggaagaaaacctggtagtactagttcacctaaggccttatcacctcctcct
tctgtggattcaaattacccaacaagagacagagcatctttcaatagaatggtcatgcat
agtgctgcttctccaacacaggcaccaatccttaatccctctatggttacaaatgaagga
cttggtcttacaactacagcttctggaacatacatctcttctaatagtctaaaagattgt
cttcctaaatcagtacaacttttgaaatctgtttttgtgaaaaatgttggttgggctaca
cagttaactagtggagctgtgtgggttcagtttaatgatgggtcccagttggttgtgcag
gcaggagtgtcttctatcagttatacctcaccaaatggtcaaacaactaggtatggagaa
aatgaaaaattaccggaatacatcaaacagaaattacagtgtctgtcttccatccttttg
atgttttctaatccgactcctaattttcactga

DBGET integrated database retrieval system