KEGG   Pongo abelii (Sumatran orangutan): 100432710Help
Entry
100432710         CDS       T01416                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1 isoform X1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04915  Estrogen signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100432710 (NCOA1)
   04919 Thyroid hormone signaling pathway
    100432710 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100432710 (NCOA1)
   05224 Breast cancer
    100432710 (NCOA1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100432710 (NCOA1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100432710 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 NCOA_u2 DUF1518 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 100432710
NCBI-ProteinID: XP_024098224
Ensembl: ENSPPYG00000012598
Position
2A
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEAGQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSTCNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSAGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAS
RNSMVSRGMTGNMGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtggatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccagggaccgagaaccaagaagctggccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctcagtcaatcctagtatctctccagctcatggtgta
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacctggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattggcaacaagg
cccaggatgccaaacaattcctttcctcctaatatttcgacattaagctctcccgttggc
atgacaagtagtacctgtaataataataaccgatcttattcaaacatcccagtaacatct
ttacagggtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatcaattttaaatgaaatgattcaatctgacaac
agctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactttca
gatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtcttgc
acaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcctctcat
agctcattgacagagcggcataaaattctacatcggctcttacaggagggtagcccctca
gatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaaggaaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagattta
agatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccttgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaataaaa
ctggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgcccacg
ctggagaaagcagcacagttgccaggcttatgtgagacagacaggatggatggtgcggtc
accagtgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgccaga
cccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaattt
ggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctataaat
cagagtaaatcagaagaccagtgtattagctcacaattagatgagcttctctgtccaccc
acaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttcctt
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcaggggggtggattagatgtattatcagagagatttccaccacaacaagcaacgcca
cctttgatgatggaagaaagacccaacctttattcccagccttactcatctccttctcct
actgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactggggacg
atgcctgttcaagtaacacctccccgaggtgctttttcagctggcatgggcatgcagccc
aggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacaacag
cgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccaattt
gcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattacacct
cagccacccctgaatgctcaaatgttggcacaacgtcagcgggaactgtacagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacccca
cctgcttcaaccagcccattttcacaactagcagcaaatcctgaagcatccttggccagc
cgcaacagcatggtgagcagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggagcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagttctctgctccagcaaactccacctgcctccgggtatcagtcacca
gacatgaaggcctggcagcaaggagcgataggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacaaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatcccgca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acgtcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system