KEGG   Pongo abelii (Sumatran orangutan): 100432828Help
Entry
100432828         CDS       T01416                                 

Gene name
USP34
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 34 isoform X1
  KO
K11853  ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100432828 (USP34)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100432828 (USP34)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100432828 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUF3517 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 100432828
NCBI-ProteinID: XP_024097798
Ensembl: ENSPPYG00000012384
Position
2A
AA seq 3546 aa AA seqDB search
MCENCADLVEVLNEISDVEGGDGLQLRKEHTLKIFTYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPLNIDRECNEGSTERQK
SIEKISNSTRICNLTEEESSKSSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNIPIGNKKEEEELRRTAPSPWSPAASPQSSDNSDTHQSGGSDIEMD
EQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQG
TSERNGTSSGTGKDLVFNTESLPSVDNRMRMLDACSHSEDPEHDISGEMNATHIAQGSQE
SCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQ
VSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPVVHKH
QFNSNAVTDINLDNVCKKGNTLLWDIVQDEDAVNLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDN
LVYYIQTVREGRQKHALYTHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSAYDGCSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFIS
KCMESLMIASSSLEQESHSSLMVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQ
EFGQSNRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERK
GEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVDDSESLRC
EELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSNDGFNWKELLKIKSAHKLLYA
LEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQLLEI
FNSGILEPKSQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRT
WPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHR
SRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCNGLYKL
SLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPILKPGCKEYFWLLCK
LVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNVEDDGLTGLLRLATSVIKH
KPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYR
LIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQ
AVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMT
EFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKN
IYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK
EKVNTHFSFPLRLDMTPYTEDFLMGKSERKEGFKEVSDHSKDSESYEYDLIGVTVHTGTA
DGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKF
MDFSFEKTHSAYMLFYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYF
GFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQ
AACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDG
SDDMDTSVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFL
LSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIAL
VALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRL
AEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPS
QCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQM
FRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMT
YCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLIV
QNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQW
AFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRS
CWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSI
FLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLL
SPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLL
PTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPL
HLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHF
LLKVQSQVFSEANCANLISTLITNLISQYQNLQSDFSSRVEISKASASLNGDLRALALLL
SVHTPKQLNPALIPTLQELLSKCRTCLQQRSSLQEQEAKERKTKDDEGATPIKRRRVSSD
EEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEVP
SSFSEDMSNIRSQHAEEQSSNGRYDDCKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDL
ADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGK
GNQAAS
NT seq 10641 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaactgcgcagacctggtggaggtgttaaatgaaatatcagatgtagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttacttatatcaattcc
tggacacagaggcaatgtctatgctgcttcaaggaatataagcatttggagatttttaat
caagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtgctccgggaccag
ctttgtaaacattgtactaccattaacatagattccacgtggcaagatgagagtaatcaa
gcagaagaaccactgaatatagatagagagtgtaatgaaggaagtacagaaagacaaaaa
tcaatagaaaaaatatcaaactctacaagaatttgtaatctgactgaggaggaatcttca
aagagttctgatccttttagtttatggagtacagatgagaaggaaaaactcttgctatgt
gtggcaaaaatttttcaaattcagtttcccttatatactgcttacaagcataatactcac
cctactattgaggatatatcaactcaagaaagtaacatattaggggcattctgtgatatg
aatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatggaactcctgaaactttgccatttctt
atagcacatgcgtttattacagttgtgtctaatattagaatatggctacatattcctgct
gtcatgcagcacattataccttttaggacctatgttattaggtatttatgcaagctctct
gatcaggagttacgacagagtgcagctcgtaacatggctgacttaatgtggagcacagtc
aaagagccattggatacaacattatgctttgataaagaaagcctagatcttgcatttaag
tactttatgtcacctactttgactatgaggttggctggattgagtcagataacgaatcaa
ctccataccttcaatgatgtgtgcaataatgaatcattagtatcggacacagaaacgtcc
attgcaaaagaacttgcagactggcttattagcaacaatgtggtggagcatatatttgga
ccaaatttacatattgagattatcaaacagtgccaagtgattttgaattttttggcagca
gaagggcgactgagtactcaacatattgactgtatttgggctgcagcacagttgaaacat
tgtagtcggtatatacatgacttatttccttcactcatcaagaatttggatcccgtacca
cttagacatctacttaatctggtctcagctcttgagccaagtgttcatactgaacagaca
ctgtacttggcatccatgttaattaaagcactgtggaataatgcactagcagctaaggct
cagttatctaaacagagttcttttgcatctttattaaatactaatattcccattggaaat
aagaaagaggaagaagagcttagaagaacagctccatcaccttggtcacctgcagctagt
cctcaaagcagtgataatagcgatacacatcaaagtggaggtagtgacattgaaatggat
gagcaacttattaatagaaccaaacatgtgcaacaacgactttcagacacagaggaatcc
atgcagggaagttctgacgaaactgccaacagtggtgaagatggaagcagtggtcctggt
agcagtagtgggcatagtgatggatctagcaatgaggtcaattctagccatgcaagccag
tcagctgggagccctggcagtgaggtacagtcagaagacattgcagatattgaagccctc
aaagaggaagatgaagacgatgatcatggtcataatcctcccaaaagcagttgtggtaca
gatcttcggaatagaaagttagagagtcaagcaggcatttgcctgggggactcccaaggc
acgtcagaaagaaatgggacaagcagcggaacaggaaaggacctggtttttaacactgaa
tcattgccatcagtagataatcgaatgcgaatgctggatgcttgttcacactccgaagac
ccagaacatgatatttcaggggaaatgaatgctactcatatagctcaagggtctcaggag
tcttgtatcacacgaactggggacttccttggggagactattgggaatgaattatttaat
tgtcgacaatttattggtccacagcatcaccaccaccaccaccaccatcaccaccaccac
gatgggcatatggttgatgatatgctaagtgcagatgatgtcagttgtagtagctcccag
gttagtgcaaaatcagaaaaaaatatggctgattttgatggtgaagaatctggatgtgaa
gaggagctagttcagattaattcacatgcggaactgacatctcacctccaacaacatctt
cccaatttagcttccatttaccatgaacatcttagtcaaggacctgtagttcataaacat
caattcaacagtaatgctgttacagacattaatttggataatgtttgcaagaaaggaaat
actttgttgtgggatatagtccaagatgaagatgcagttaatctttctgaaggattaata
aatgaagcagagaaacttctttgttcgttagtgtgttggtttacagatagacagattcga
atgagattcattgaaggttgccttgaaaacttgggaaacaacagatcagtagtaatttca
cttcgtcttcttccaaaactatttggtacttttcagcagtttgggagcagttatgataca
cactggataacaatgtgggcagaaaaagaactgaacatgatgaagcttttctttgataat
ttggtatactacattcaaactgtgagagaaggaagacaaaaacatgcactgtacacccat
agtgctgaagttcaagttcgccttcaattcttgacttgtgtattttcaactctgggatca
cctgatcatttcaggttaagtttagagcaagttgacatcttatggcattgtttagtagaa
gattctgaatgttatgatgatgcactacattggtttttaaatcaagttcgaagtaaagat
caacatgctatgggtatggaaacctacaaacatcttttcctggagaagatgccccagcta
aaacctgaaacaattagcatgactggcttaaacctgtttcagcatctctgtaacttggct
cgattggctaccagtgcctatgatggttgttcaaattctgagctgtgtggtatggaccaa
ttttggggcattgctttaagagcacaatctggtgatgtcagtcgagcagctatccagtat
attaactcctattatattaatggtaaaacgggtttggagaaggagcaagaatttattagt
aagtgcatggagagtcttatgatagcttctagcagtcttgagcaggaatcacactcgagt
ctcatggttatagaaagaggactccttatgctgaagacacatctggaagcgtttaggaga
aggtttgcatatcatctgagacagtggcaaattgaaggcactggtattagtagtcatttg
aaagcactgagtgacaaacagtccctgccactaagggttgtatgccagccagctggactt
cctgacaagatgactattgaaatgtatcctagtgaccaggtagcagatcttagggctgaa
gtaactcattggtatgaaaatttacagaaagaacaaataaatcaacaagctcagcttcag
gagtttggtcaaagcaaccgaaaaggagagtttcctggaggcctcatgggacctgtcagg
atgatttcatctggacatgagttaacaacagattatgatgaaaaagcacttcatgagctc
ggttttaaggatatgcagatggtatttgtgtctttgggtgcaccaaggagagaacggaaa
ggggaaggtgttcagctgccagcatcttgcctcccaccccctcagaaggacaacattcca
atgcttttgcttttacaagaacctcatttaactactctttttgatttattagagatgctt
gcatcatttaaaccaccctcaggaaaagtggcagtggatgatagtgagagcttacgatgt
gaagaacttcatcttcatgcagaaaatctgtctaggcgggtctgggagctactgatgctt
cttcctacatgtcctaatatgttgatggcattccagaatatctcagatgagcagagtaat
gatggatttaattggaaagaacttctcaaaattaagagcgcccacaagctattgtatgct
ctggaaattattgaagcactgggaaaacctaatagaagaataaggagggagtctacggga
agttacagtgatctttatccagattcagatgattcaagtgaggatcaagtggaaaatagt
aaaaattcctggagttgcaagtttgttgctgctggagggcttcaacagttactagaaatt
tttaattctggaattctagagcctaaatcgcaggaatcatggactgtgtggcagctagac
tgtcttgcttgcttgctgaagttaatatgccagtttgcagtagatccatccgatttggat
ttagcttatcatgatgtctttgcctggtctggtatagcagaaagccataggaaaagaacc
tggcctggcaaatcaaggaaggctgctggtgatcatgctaagggtcttcatataccacga
ttaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcgacttatgtct
gttgcttatacgtatgataatctggctcctagagttttaaaagctcagtctgatcacagg
tctagacatgaagtttcacattattcaatgtggctcttggtgagttgggctcattgctgt
tctttagtgaaatctagccttgctgatagtgatcatttacaagattggctaaagaaattg
actctccttattcctgagactgcagttcgtcatgaatcatgcaatggtctctataagtta
tccctgtcagggctggatggaggagactcaatcaatcgttcttttctgctattggctgcc
tcaacattactgaaatttcttcctgatgctcaagcactcaaacctattaggatagatgat
tatgaggaagaaccaatattaaaaccaggatgtaaagagtatttttggttgttatgcaaa
ttagttgacaacatacatataaaggacgctagtcagacaacgctcctcgacttagatgcc
ttggcaagacatttggctgactgtattcgaagtagggagatccttgatcatcaggatggt
aatgtagaagatgatgggcttacaggactcctaaggcttgcaacaagtgttattaaacac
aaaccaccctttaaattttcaagagaaggacaggaatttttgagagatatcttcaatctc
ttgtttttgttgccaagtctgaaggaccgacaacagccaaagtgcaaatcacattcttca
agagctgctgcttacgatttgttagtagagatggtaaaggggtctgttgagaactacagg
ctaatacacaactgggttatggcacaacacatgcagtcccatgcaccttataaatgggat
tactggcctcatgaagatgtccgtgctgaatgtagatttgttggccttactaaccttgga
gctacttgttacttagcttctactattcagcaactttatatgatacctgaggcaagacag
gctgtcttcactgccaagtattcagaggatatgaagcacaagaccactcttctggagctt
cagaaaatgtttacatatttaatggagagtgaatgcaaagcatataatcctagacctttc
tgtaaaacatacaccatggataagcagccactgaatactggggaacagaaagatatgaca
gagttttttactgatctgattaccaaaatcgaagaaatgtctccagaactgaaaaatact
gtcaaaagtttatttggaggtgtaattacaaacaatgttgtatccttggattgtgaacat
gttagtcaaactgctgaagagttttatactgtgaggtgccaagtggctgatatgaagaac
atttatgaatctcttgatgaagttactataaaagacactttggaaggtgataacatgtat
acttgttctcattgtgggaagaaagtacgagctgaaaaaagggcatgttttaagaaactg
cctcgcattttgagtttcaatactatgagatatacatttaatatggtcacgatgatgaaa
gagaaagtgaatacacacttttccttcccattacgtttggacatgacgccctatacagaa
gattttcttatgggaaagagtgagaggaaagaaggttttaaagaagtcagtgatcattca
aaagactcagagagctatgaatatgacttgataggagtaactgttcacacaggaacggca
gatggtggacactattatagctttatcagagatatagtaaatccgcatgcttataaaaac
aataaatggtatctttttaatgatgctgaggtaaaaccttttgattctgctcaacttgca
tctgaatgttttggtggagagatgacgaccaagacctatgattctgttacagataaattt
atggatttctcttttgaaaagacacacagtgcatatatgctgttttacaaacgcatggaa
ccagaggaagaaaatggcagagaatacaaatttgatgtttcgtcagagttactggagtgg
atttggcatgataacatgcagtttcttcaagacaaaaacatttttgaacatacgtatttt
ggatttatgtggcaattgtgtagttgtattcccagtacattaccagatcctaaagctgtg
tccttaatgacagcaaagttaagcacttcctttgtcctagagacatttattcattctaaa
gaaaagcccacaatgcttcagtggattgaactgttgaccaaacagtttaataatagtcag
gcagcttgtgagtggtttttagatcgcatggctgatgacgactggtggccaatgcagata
ctaattaagtgccctaatcaaattgtgagacagatgtttcagcgtttgtgtatccatgtg
attcagaggctgagacctgtgcatgctcatctctatttgcagccaggaatggaagatggg
tcagatgatatggatacctcagtagaagatattggcggtcgttcatgtgtcactcgcttt
gtgagaaccctgttattaattatggaacatggtgtgaaacctcacagtaaacatcttaca
gaatattttgccttcctttacgaatttgcaaaaatgggtgaagaagagagccaatttttg
ctttcattgcaagctatatctacaatggtacatttttacatgggaacaaaaggacctgaa
aatcctcaagttgaagtgttatcagaggaagaaggggaagaagaggaggaggaagaagat
atcctctctctggcagaagaaaagtacaggccagctgcccttgaaaagatgatagcttta
gttgctcttttggttgaacagtctcgatcagaaaggcatttgacattatcacagactgac
atggcagcattaacaggaggaaagggatttcccttcttgtttcaacatattcgtgatggc
atcaatataagacaaacttgtaatctgattttcagcctgtgtcgatacaataatcgactt
gcagaacatattgtatctatgcttttcacatcaatagcaaagttgactcctgaggcagcc
aatcctttctttaagttgttgactatgctaatggagtttgctggtggacctccaggaatg
cctccctttgcatcttacattctgcagaggatatgggaggtgattgaatacaatccttct
cagtgtctagattggttggcagtgcagacaccccgaaataaactggcacacagctgggtc
ttacagaatatggaaaactgggtcgagcggtttcttttggctcacaattatcctagagtg
aggacttctgcagcttatcttctggtgtcccttataccaagcaattcattccgtcagatg
ttccggtcaacaaggtctttgcacatcccaacccgtgaccttccactcagtccagacacg
acagtagtcctacatcaggtctacaacgtgctccttggtttgctctcaagagccaaactt
tatgttgatgctgctgttcatggcactacaaagctagtgccctattttagctttatgact
tactgtttaatttccaaaactgagaagctgatgttttccacatatttcatggatttgtgg
aaccttttccagcctaaactttctgagccagcaatagctacaaatcacaataaacaggct
ttgctttcattttggtacaatgtctgtgctgactgtcccgagaatatccgccttattgtt
cagaacccagtggtaaccaagaacattgccttcaattacatccttgctgaccatgatgat
caggatgtggtgctttttaaccgtgggatgctgcctgcctactatggcattctgaggctc
tgctgtgagcagtctcctgcattcacacgacaactggcttctcaccagaacatccagtgg
gcctttaagaatcttacaccacatgccagccaataccctggagcagtagaagagctattt
aacctgatgcagctgtttatagctcagaggccagatatgagagaagaagaattagaagat
attaaacagttcaagaaaacaaccataagttgttacttacgttgcttagatggccgctcc
tgctggactactttaataagtgccttcagaatactattagaatctgatgaagacagactt
cttgttgtatttaatcgcggattaattctaatgacagagtctttcaacactttgcacatg
atgtatcacgaagctacagcttgccatgtgactggagatttagtagaacttctgtcaata
tttctttcggttttgaagtctacacgcccttatcttcagagaaaagatgtgaaacaagca
ttaatccagtggcaggagcgaattgaatttgcccataaactgttaactcttcttaattcc
tatagtcctccagaacttagaaatgcctgtatagatgtcctcaaggaacttgtacttttg
agtccccatgattttcttcatactctggttccctttctacaacacaaccattgtacttac
catcacagtaatataccaatgtctcttggaccttattttccttgtcgagaaaatatcaag
ctaataggagggaaaagcaatattcggcctccgcgccctgaactcaatatgtgcctcttg
cccacaatggtggaaaccagtaagggcaaagatgacgtttatgatcgtatgctgctagac
tacttcttttcttatcatcaattcatccatctattatgccgagttgcaatcaactgtgaa
aaatttactgaaacattagttaagctgagtgtcctagttgcctatgaaggtttgccactt
catcttgcactgttccccaaactttggactgagctatgccagactcagtctgctatgtca
aaaaattgcatcaagcttttgtgtgaagatcctgttttcgcagaatatattaaatgtatc
ctaatggatgaaagaacttttttaaacaacaacattgtctacacgttcatgacacatttc
cttctaaaggttcaaagtcaagtgttttctgaagcaaactgtgccaatttgatcagcact
cttattacaaacttgataagtcagtatcagaacctacagtctgatttctccagccgagtt
gaaatttccaaagcaagtgcttctttaaatggggacctgagggcacttgctttgctcctg
tcagtacacactcccaaacagttaaacccagctctaattccaactctgcaagagctttta
agcaaatgcaggacttgtctgcaacagagaagctcactccaagagcaagaagccaaagaa
agaaaaactaaagatgatgaaggagcaactcccattaaaaggcggcgtgttagcagtgat
gaggagcacactgtagacagctgcatcagtgacatgaaaacagaaaccagggaggtcctg
accccaacgagcacttctgacaatgagaccagagactcctcaattattgatccaggaact
gagcaagatcttccttcccctgaaaatagttctgttaaagaataccgaatggaagttcca
tcttcgttttcagaagacatgtcaaatatcaggtcacagcatgcagaagaacagtccagc
aatggtagatatgacgattgtaaagaatttaaagacctccactgttccaaggattctacc
ctagctgaggaagaatctgagttcccttctacttctatctctgcagttctgtctgactta
gctgacttgagaagctgtgatggccaagctttgccctcccaggatcctgaggttgcttta
tctctcagttgtggccattccagaggactctttagtcatatgcagcaacatgacatttta
gataccctgtgtaggaccattgaatctacaatccatgtggtcacaaggatatctggcaaa
ggaaaccaagctgcttcttga

DBGET integrated database retrieval system