KEGG   Pongo abelii (Sumatran orangutan): 100433198Help
Entry
100433198         CDS       T01416                                 

Gene name
CYSLTR2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100433198 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100433198 (CYSLTR2)
G protein-coupled receptors [BR:pon04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100433198 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TAS2R Tegument_dsDNA DUF412
Motif
Other DBs
NCBI-GeneID: 100433198
NCBI-ProteinID: XP_009246920
Ensembl: ENSPPYG00000005362
UniProt: A0A2J8VSH3
Position
13
AA seq 347 aa AA seqDB search
MERKFMSLHPSISISEMEPNGTFSNNNNSRNCTIKNFKTEFFPIVYLIIFVWGVLGNGLS
IYVFLQPYKKSTSVNIFMLNLAISDLLFISTLPFRAYYYLRGSNWIFGDLACRIMSYSFY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRTAWILCGIIWILIMASSIMLLDSGSE
QKGSVTSCLELNLYKIAKLQTMNYIALVVGFLLPFFTLSICYLLIIRVLLKVEVPESGLQ
VSHKKALTTIIITLIIFFLCFLPYHTLRTLHLATWKVGICKDRLHKAVVITLALAAANTC
FNPLLYYFAGENFKDRLRSALRKGHPQKAKTKCAFPVSVWLRKETRV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcatccatccatctccatatcagaaatggaaccaaat
ggcaccttcagcaataacaacaatagcaggaactgcacaatcaaaaacttcaagacagaa
tttttcccaattgtatatctgataatatttgtctggggagtattgggaaatggtttgtcc
atatatgttttcctgcagccttataagaagtccacatctgtgaacattttcatgctaaat
ctggccatttcagatctcctgttcataagcacgcttcccttcagggcttactattacctt
agaggctccaattggatatttggagacctggcctgcaggattatgtcttattctttctat
gtcaacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggca
acggttcacccctttcggcttctgcatgtcaccagcatcaggactgcctggatcctctgt
gggatcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgag
cagaagggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcag
accatgaactatattgccttggtggtgggcttcctgctgccatttttcacactcagcatc
tgttatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcag
gtttctcacaagaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgt
ttcctgccctatcacacactgaggaccctccacttggcgacatggaaagtgggtatatgc
aaagacaggctgcataaagctgtggttatcacactggccttggcggcagccaatacctgc
ttcaatcctctgctctattactttgctggggagaattttaaggacagactaaggtctgca
ctcagaaaaggccatccacagaaggcaaagacaaagtgtgctttccctgttagtgtgtgg
ttgagaaaggaaacaagagtataa

DBGET integrated database retrieval system