KEGG   Pongo abelii (Sumatran orangutan): 100433878Help
Entry
100433878         CDS       T01416                                 

Gene name
NSD2
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
pon05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100433878 (NSD2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100433878 (NSD2)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100433878 (NSD2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100433878 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100433878
NCBI-ProteinID: XP_002814554
Ensembl: ENSPPYG00000014534
Position
4
AA seq 1365 aa AA seqDB search
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGK
STPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRTQDPTEDAE
AEDTPRKRLRMDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSLGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaagcagagtcccctttctgttcagagtgttgtaaagtgcataaag
atgaagcaggcgccggaaatcctcggcagtgccaacgggaagactccgagctgcgaggtg
aatcgcgagtgttctgtgttcctcagcaaagcccagctctccagtagcctgcaggagggg
gtcatgcagaagtttaacggccacgacgccttgccctttattccagccgacaagctgaaa
gatcttacttcccgggtgtttaatggagaacccggcgcacacgatgccaaactgcgtttt
gagtcccaggaaatgaaagggattgggacaccccctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacgtacatgaatgggaagcctctctttgaa
tcttccatttgtggtgacagtgctgctgatgtgtctcagtcagaagaaaatggacaaaaa
ccagaaaacaaggcgagaaggaacaggaagaggagcataaaatatgactccttgctggag
cagggccttgtcgaagcagctcttgtgtctaagatctcaagtccttcagataaaaagatt
ccagctaagaaagagtcttgtccaaacactggaagagacaaagaccacctgttgaaatac
aacgttggtgatttggtgtggtccaaagtgtcgggttacccttggtggccttgcatggtt
tctgcggatccactccttcacagctataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgacgccccagaaagagcttggatatttgagaagagc
ctcgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctattgaaaccaatttcagggaaattgagggcc
cagtgggaaatgggcattgttcaagcagaagaagctgcaagcatgtcagtggaggagcgg
aaagccaagttcacctttctctatgtgggggaccagcttcatctcaaccctcaagtagcc
aaggaggctggcattgctgcagagtctttgggagaaatggcagaatcctcaggagtcagt
gaagaagctgctgaaaaccccaagtctgtgagagaagagtgcattcccatgaagagaagg
cggagggccaaactgtgtagctctgcagagaccctggagagtcaccccgacatagggaag
agtactcctcaaaagacagcagaggctgaccccagaagaggagtagggtctcctcctggg
aggaagaagaccacagtctccatgccacgaagcaggaagggagatgcagcatcccagttt
ttggtcttctgtcaaaaacacagggatgaggtggtagctgagcacccggatgcttcaggt
gaggagattgaagagctgctcaggtcacagtggagtctgctgagtgagaagcagagagca
cgctacaacaccaagtttgccctggtggcccctgtccaggctgaagaagactctggtaac
gtaaatgggaaaaaaagaaaccacacaaagaggacacaggaccctacagaagatgctgaa
gctgaggacacacccaggaaaagactcaggatggacaagcacagtcttcggaagagagac
acaatcactgacaaaacggccagaacaagctcttacaaggccatggaggcagcctcctcg
ctcaagagccaggcagcaacgaaaaatctgtctgatgcatgcaaaccactgaagaagcga
aatcgggcttccacggcagcatcttcagctcttgggtttagcaaaagttcatctccttct
gcatccttaactgagaatgaggtctcggacagcctgggagacgagccctcggagtcccca
tacgaaagtgcagacgaaacacaaactgaagtgtccgtctcatccaaaaagtctgagcga
ggagtgactgccaaaaaggagtatgtgtgccagctgtgtgagaagccgggcagcctcctg
ctctgtgaaggaccctgctgcggagctttccacctcgcctgccttgggctttcccggagg
ccagaagggaggttcacctgcagtgagtgtgcctcagggattcactcatgtttcgtgtgt
aaagagagcaagacagatgttaagcgctgtgtggtaactcagtgtggaaaattttaccat
gaggcttgtgtgaaaaaataccccctgactgtatttgagagccgaggtttccgctgcccc
ctccacagctgtgtgagctgccatgcttccaacccttcaaacccaaggccgtcgaaaggt
aaaatgatgcggtgtgtccgctgccctgttgcctatcacagcggagatgcttgtctggca
gcaggatgctcagtgatcgcctccaacagcatcatctgcactgctcacttcactgctcgg
aaggggaagcgacaccacgcccacgtcaacgtgagctggtgcttcgtgtgctccaaaggg
gggagccttctgtgctgtgagtcctgcccagcggccttccaccctgactgcctgaacatc
gagatgcctgacggcagctggttctgcaatgactgtagggctgggaagaagctgcacttc
caggatatcatttgggtgaaacttgggaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgtg
tttttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcactgcaagaagctgaagctcgttttcgtgaaattaagcttcagagggaagcccgagaa
acacaggagagcgagcgcaagcccccaccatacaagcacatcaaggtgaataagccttac
gggaaagtccagatctacacagcggatatttcagaaatccctaagtgcaactgcaagccc
acagatgagaatccttgtggctttgattcggagtgtctgaacaggatgctgatgtttgag
tgccacccgcaggtgtgtcccgcgggcgagttctgccagaaccagtgcttcaccaagcgc
cagtacccagagaccaagatcatcaagacagatggcaaagggtggggcctggtcgccaag
agggacatcagaaagggagaatttgttaacgagtacgttggggagctgatcgacgaggag
gagtgcatggcgagaatcaagcacgcacacgagaacgacatcacccacttctacatgctc
actatagacaaggaccgtataatagacgctggccccaaaggaaactactctcgatttatg
aatcacagctgccagcccaactgtgagaccctcaagtggacagtgaacggggacactcgt
gtgggcctgtttgctgtctgtgacattcctgcagggacggagctgacttttaactacaac
ctcgattgtttgggcaatgaaaaaacggtctgccggtgtggagcctccaattgcagtgga
ttcctcggggatagaccaaagacctcgacgaccctttcatcagaggaaaagggcaaaaag
accaagaagaaaaccaggcggcgcagagcaaaaggggaagggaagaggcagtcagaggac
gagtgcttccgctgcggtgatggcgggcagctggtgctgtgtgaccgcaagttctgcacc
aaggcctaccacctgtcctgcctgggccttggcaagcggcccttcgggaagtgggaatgt
ccttggcatcattgtgacgtgtgtggcaaaccttcgacttcattttgccacctctgcccc
aattcgttctgcaaggagcaccaggacgggacagccttcagctgcaccccggacgggcgg
tcctactgctgtgagcatgacttaggggcggcatcggtcagaagcaccaagactgagaag
ccccccccagagccagggaagccaaaggggaagaggcggcggcggaggggctggcggaga
gtcacagagggcaaatag

DBGET integrated database retrieval system