KEGG   Pongo abelii (Sumatran orangutan): 100434727Help
Entry
100434727         CDS       T01416                                 

Gene name
KAT2A
Definition
(RefSeq) histone acetyltransferase KAT2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04330  Notch signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05166  HTLV-I infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100434727 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100434727 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100434727 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100434727 (KAT2A)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100434727 (KAT2A)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100434727 (KAT2A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100434727 (KAT2A)
   HAT complexes
    PCAF complex
     100434727 (KAT2A)
    STAGA complex
     100434727 (KAT2A)
    TFTC complex
     100434727 (KAT2A)
    SAGA complex
     100434727 (KAT2A)
    SLIK complex
     100434727 (KAT2A)
    ADA-HAT complex
     100434727 (KAT2A)
    HAT-A2 complex
     100434727 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 100434727
NCBI-ProteinID: XP_024090181
Position
17
AA seq 837 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPTPTPTPAPAPAPAAAPASSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgactccg
actcccactccggcaccagcccctgccccagctgcagccccagccagcagcacaggaact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatcctgctcgacctggc
ctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaaatgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgaccacgtatcccac
ttggagaatgtgtcagaggatgagataaaccgactgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaagaggacacagacaccaagcaggtctatttctac
ctcttcaagctactgcggaaatgcatcctgcagatgacccggcccgtggtggaggggtcc
ctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctctcaaagatg
ttcttgctctgccttaactactggaagcttgagacacctgcccagtttcggcagaggtct
caggctgaggacgtggctacctacaaggtcaattacaccagatggctctgttactgccac
gtgccccagagctgtgatagcctcccccgctacgaaaccactcacgtctttgggcgaagc
cttctccggtccattttcactgttacccgccggcagctgctggaaaagttccgagtggag
aaggacaaattggtgcctgagaagaggaccctcatcctcactcacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtcaggcttcacc
atgccaccctcagaggggacacagctggtgccccggccagcttcagtcagtgcagcggtt
gttcccagcacccccatcttcagccccagcatgggtgggggcagcaacagctccctgagt
ctggattctgcaggggccgagcctatgccaggcgagaagaggaagctcccagagaacctg
accctggaggatgccaagcggctccgtgtgatgggtgacatccccatggagctggtcaat
gaggtcatgctgaccatcactgaccctgctgccatgctggggcctgagacgagcctgctt
tcggccaatgcggcccgggatgagacagcccgcctggaggagcgccgcggcatcatcgag
ttccatgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctgtggctc
gtggggctgcagaatgtcttttcccaccagctgccacgcatgcctaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggacgggcgggtcatc
ggtggcatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcgaatgagcaggtcaagggttatgggacccacctgatgaaccacctgaaggag
tatcacatcaagcacaacattctctacttcctcacctacgccgacgagtacgccatcggc
tacttcaaaaagcagggtttctccaaggacatcaaggtgcctaagagccgctacctgggc
tacatcaaggactacgagggagcgacgctgatggagtgtgagctgaatccccgcatcccc
tacacggagctgtcccacatcatcaagaagcagaaagagatcatcaagaagctgattgag
cgcaaacaggcccagatccgcaaggtctacccggggctcagctgcttcaaggagggtgtg
aggcagatccctgtggagagcgttcccggcattcgagagacaggctggaagccattgggg
aaggagaaggggaaggagctgaaggaccctgaccagctctacacaacccttaaaaacctg
ctggcccaaatcaagtcgcaccccagtgcctggcccttcatggagcctgtgaagaagtcg
gaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgactgag
cggctgcgaagccgctactatgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgtcgcgagtacaaccccccggacagcgagtactgccgctgcgccagcgct
ctggagaagttcttctacttcaagctcaaggagggagggctcattgacaagtag

DBGET integrated database retrieval system