KEGG   Pongo abelii (Sumatran orangutan): 100435042Help
Entry
100435042         CDS       T01416                                 

Gene name
NAT1
Definition
(RefSeq) arylamine N-acetyltransferase 1 isoform X2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00232  Caffeine metabolism
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100435042 (NAT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100435042 (NAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100435042 (NAT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100435042 (NAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100435042
NCBI-ProteinID: XP_002818888
Ensembl: ENSPPYG00000018394
Position
8
AA seq 377 aa AA seqDB search
MGFLLWMLLPCSDTMPTTMTCTEGPWLLLLLHKEAALEPQGPAVGYNSLQVSEDHHVSGI
QARKKQHSVFWIKTEDQPTFNLLRKGIMDIEAYLERIGYKKSRNKLDLETLTDILQHQIR
AVPFENLNIHCGEAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTSIGFETTMLGGYV
YSTPAKKYSTGMIHLLLQVTIDSRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCIFRLT
EENGFWYLDQIRREQYIPNEEFLNCDLLEDSKYRKIYSFTLEPRTIEDFESMNTYLQTSP
ASVFTSKSFCSLQTPDGVHCLVGFTLTYRRFNYKDNTDLIEFKTLNEEEIEKVLKNIFNI
SLERKLVPKHGDRFFTI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctactctggatgctgctcccatgctctgacacgatgcctactacaatgact
tgtacagaagggccatggctgttattactcttacacaaggaggcagccctcgagccacag
ggtccagctgtcggctataatagcctacaggtctctgaagatcaccatgtttctggaatt
caagccaggaagaagcagcattctgtcttctggattaaaactgaagatcaacctactttc
aacttactaagaaaggggatcatggacattgaagcatatcttgaaagaattggctataag
aagtctaggaacaaattggacttggaaacattaactgacattcttcagcaccagatccga
gctgttccatttgagaaccttaacatccattgcggggaagccatggacttaggcttagag
gccatttttgatcaagttgtgagaagaaatcggggtggatggtgtctccaggtcaatcat
cttctgtactgggctctgacctctattggttttgagaccacgatgttgggagggtatgtt
tacagcactccagccaaaaaatacagcactggcatgattcaccttcttctgcaggtgacc
attgacagcaggaactacattgtcgatgctgggtttggacgctcataccaaatgtggcag
cctctggagttaatttctgggaaggatcagcctcaggtgccttgcatcttccgcttgacg
gaagagaatggattctggtatctagaccaaatcagaagggaacagtacattccaaatgaa
gaatttcttaattgtgatctcctagaagacagcaaataccgaaaaatctactcctttact
cttgagcctcgaacaattgaagattttgagtctatgaatacatacctgcagacatctcca
gcatctgtgtttactagtaaatcattttgttccttgcagaccccagatggggttcactgt
ttggtgggcttcaccctcacctataggagattcaattataaggacaatacagatctgata
gagttcaagactctgaatgaggaagaaatagaaaaagtgctgaaaaatatatttaatatt
tccttggagagaaagcttgtgcccaaacatggtgatagattttttactatttag

DBGET integrated database retrieval system