KEGG   Pongo abelii (Sumatran orangutan): 100435277Help
Entry
100435277         CDS       T01416                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00350  Tyrosine metabolism
pon00360  Phenylalanine metabolism
pon00380  Tryptophan metabolism
pon01100  Metabolic pathways
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05034  Alcoholism
Module
pon_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
pon_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100435277 (DDC)
   00360 Phenylalanine metabolism
    100435277 (DDC)
   00380 Tryptophan metabolism
    100435277 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100435277 (DDC)
   04726 Serotonergic synapse
    100435277 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100435277 (DDC)
   05031 Amphetamine addiction
    100435277 (DDC)
   05034 Alcoholism
    100435277 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100435277 (DDC)
Enzymes [BR:pon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100435277 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     100435277 (DDC)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100435277 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100435277
NCBI-ProteinID: XP_024105535
Ensembl: ENSPPYG00000017558
Position
7
AA seq 480 aa AA seqDB search
MNTSEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPATAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLAEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFVV
ATLGTTTCCSFDSLLEVGPICNKEDMWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaagtgaattccgaaggagagggaaggagatggtggattacgtggccaactac
atggaaggcattgagggacgccaggtctaccctgacgtggagcccgggtacctgcggccg
ctgatccctgccactgcccctcaggagccagacacgtttgaggacatcatcaatgacgtt
gagaagataatcatgcctggggtgacgcactggcacagcccctacttcttcgcctacttc
cccactgccagctcgtacccggccatgctagcagacatgctgtgcggggccattggctgc
atcggcttctcctgggcggcaagcccagcatgcacagagctggagactgtgatgatggac
tggctcgggaagatgctggaactaccaaaggcatttttggctgagaaagctggagaaggg
ggaggagtgatccagggaagtgccagcgaagccaccctggtggccctgctggccgctcgg
accaaagtgatccatcggctgcaggcagcgtccccagagctcacacaagccgctatcatg
gagaagctggtggcttactcatccgatcaggcacactcctcagtggaaagagctgggtta
attggtggagtgaaattaaaagccatcccctcagatggcaacttcgccatgcgtgcgtct
gccctgcaggaagccctggagagagacaaagcggctggcctgattccgttcttcgtggtt
gccaccctggggaccacaacatgctgctcctttgacagtctcttagaagtcggtcctatc
tgcaacaaggaagacatgtggctgcacgtcgatgcggcctacgcaggcagtgcgttcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctattggtgaattttgactgctctgccatgtgggtgaaaaagagaaca
gacttaacgggagcctttagactggaccccacttacctgaagcacagccatcaggattca
gggcttatcactgactaccggcactggcagataccactgggccgaagatttcgctctttg
aaaatgtggtttgtatttaggatgtatggagtcaaaggactgcaggcttatatccgcaag
catgtccagctgtcccatgagtttgagtcactggtgcgccaggatccccgctttgaaatc
tgtgtggaagtcattctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacagtgccaaaaaaatccacttggttccatgtcacctc
agggacaagtttgtcctgcgctttgccatctgctctcgcaccgtggaatctgcccacgtg
cagcgggcctgggaacacatcaaagagctggcggccgacgtgctgcgagcagagagggag
tag

DBGET integrated database retrieval system