KEGG   Pongo abelii (Sumatran orangutan): 100436057Help
Entry
100436057         CDS       T01416                                 

Gene name
WNK1
Definition
(RefSeq) serine/threonine-protein kinase WNK1 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100436057 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100436057 (WNK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100436057 (WNK1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  Wnk family
   100436057 (WNK1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100436057 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100436057
NCBI-ProteinID: XP_009245562
Ensembl: ENSPPYG00000004136
UniProt: H2NG28
Position
12
AA seq 2382 aa AA seqDB search
MSGGAAEKQSGTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVAGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSVSVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQG
QPSSSSLTGVSSSQSIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAP
QVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTSLLPQYP
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLL
QPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNI
APSSHVASVCTHPTVLSPPMPTEALAAPGLFPTVAQPYVESNLLVPVGAVGGQVQVSQPG
VSLAQAPTTSSQQAVLESTQGVSQVAPTEPVPVAQPQPTQPTTLASSIDSAHSDVASGMS
DGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETH
NRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEP
EGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV
SPVPESRLRESKVFPSEITDTVAASTSQSPGMNLSHSASSLSLQQAFSELRRTQMTEGPN
TAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATVPVTATSSPPNDISTSVIQSEVTVPTE
EGIAGVATSTGVATSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEN
IVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPS
TASQLSIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSS
VSQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVASVPAVQQTLIHS
QPQPALLPNQPHTHCPEIDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET
SLVIESTVTPGIPTTAVAPSKLLTSATSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVST
TTSGLKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQL
RRTLSPEIITVTSAVGPVPVVVPTAITEAGAQPQKDVSQVKEGPVLATSSGAGVFKMGRF
QVSVAADDAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSD
VPESAHKTTASEAKSDTGQPTKVGRFQVTTTAKKVGRFSVSKTEDKITDTKKEGPVASPP
FMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDLEAAFLSRDVDDGSGSPHSPHQLSSKS
LPIQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASV
LHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTN
TVGATVNSQAAQSQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSRGHTNYEGPG
MARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGT
GGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT
NT seq 7149 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcagagaagcagagcggcactcccggttccctgttcctctcgccg
ccggctcctgcccccaagaatggctccagctccgattcctccgtgggggagaagctggga
gccgcggccgccgacgctgtggccggcaggaccgaggagtacaggcgccgccgccacact
atggacaaggacagccgtggggcggccgcgaccactaccaccactgagcaccgcttcttc
cgccggagtgtcatctgcgactccaatgccactgcactggagcttcccggccttcctctt
tccctcccccagcccagcatccccgcggctgtcccgcagagtgctccaccggagccccac
cgggaagagaccgtgaccgccaccgccacttcccaggtagcccagcagcctccagccgct
gccgcccctggggaacaggccgtcgcgggccctgccccctcgactgtccccagcagtacc
agcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgccg
gcgagaagtggcagcggcggcggcagcgccaaggagccgcaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgatggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctagac
actgaaaccaccgtggaagtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaaaggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacatctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagtcctaagaagctggtgccgtcagatccttaaaggacttcagtttcttcatact
cgaactccacctatcattcaccgtgatcttaaatgtgacaacatctttatcaccggccct
actggctcagtcaagattggagaccttggtctggcaaccctgaagcgggcttcttttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccaaaatgctgcgcagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaatcattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaaccatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagacgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagataatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgctcaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagaggaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaagcaggaagagagcagtctcaaacagcaggtagaacaatccagtgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctacagcttctaccacttca
gcttcagtttctacacaagtagaacctgaagaacctgaggcagatcaacatcaacaacta
cagtaccagcaacccagtgtatctgtgttatctgatgggacagttgacagtggtcaggga
tcctctgtcttcacagaatctcgagtgagcagccaacagacagtttcatatggttcccag
catgaacaggcacattctacaggcacagtcccagggcatataccttctactgtccaagca
cagtctcagccccatggggtatatccaccctcaagtgtggcacaggggcagagccagggt
cagccatcctcaagtagcttaacaggggtttcatcttcccaatccatacaacatcctcag
cagcagcagggaatacagcagacagcccctcctcaacagacagtgcagtattcactttca
cagacatcaacctccagtgaggccactactgcacagccagtgagtcaacctcaagctcca
caagtcttgcctcaagtatcagctggaaaacagcttccagtttcccagccagtaccaact
atccaaggcgaacctcagatcccagttgcgacacaaccctcggttgttccagtccactct
ggtgctcatttccttccagtgggacagccgctccctacttccttgctccctcagtaccct
gtctctcaaattcccatatcaactcctcatgtgtctacggctcagacaggtttctcatcc
cttcccatcacaatggcagctggcattactcagcctctgctcacgttggcttcatctgct
acaacagctgcgatcccgggggtatcaactgtggttcctagtcagcttccaacccttctg
cagcctgtgactcagctgccaagtcaggttcacccacagctcctacaaccagcagttcag
tccatgggaataccagctaaccttggacaagctgctgaggttccactttcctctggagat
gttctgtaccagggcttcccacctcgactgccaccacagtacccaggagattcaaatatt
gctccctcttcccacgtggcttctgtttgcacccaccctacagtcctgtcccctcccatg
ccgacagaagcactggctgcacctgggctctttcccacggtggcgcagccttatgtggaa
tcaaatcttttagttcctgtgggtgctgtaggaggacaggttcaagtgtcccagccagga
gtgagtttagcacaagcccccactacatcctcccagcaagcagttttggagagtactcag
ggagtctctcaggttgctcctacagagccagttccagtagcacagccacaacctacccag
ccgaccactttggcttcctctatagacagtgcacattcagatgttgcttcaggtatgagt
gatggcaatgagaatgtcccatcttccagtggaaggcatgaaggaagaactacaaaacgg
cattaccgaaaatctgtaaggagtcgctctcgacatgaaaaaacttcacgcccaaaatta
agaattttgaatgtttcaaataaaggagaccgagtagtagaatgtcaattagagactcat
aataggaaaatggttacattcaaatttgacctagatggtgacaaccccgaggagatagca
acaattatggtgaacaatgactttattctagcaatagagagagagtcatttgtggatcaa
gtgcgagaaattattgaaaaagctgatgaaatgctcagtgaggatgtcagtgtggaacca
gagggtgaccagggattggagagtctacaaggaaaggatgactatggcttttcaggttct
cagaaattggaaggagagttcaaacaaccaattcctgcgtcttccatgccacagcaaata
ggcattcctaccagttctttaactcaagtcgttcattctgctggaagacggttcatagtg
agtcctgtgccagaaagccgattacgagaatcaaaagttttccccagtgaaataacagat
acagttgctgcctctacatctcagagccctggaatgaacttgtctcactctgcatcatcc
cttagtctacaacaggccttttctgaacttagacgtacccaaatgacagaaggacccaat
acagcacctccaaactttagtcatacaggaccaacatttccagtagtacctcctttctta
agtagcattgctggagtcccaaccacagcagcagccacagtaccagtcactgcaacaagc
agccctcctaatgacatttccacatcagtaattcagtctgaggttacagtgcccactgaa
gaggggattgctggagttgccaccagcacgggtgtggcaacttcaggtggtctccccata
ccacctgtgtctgaatcaccagtactttccagtgtagtttcaagtatcacaatacctgca
gttgtctcaatatctactacatccccgtcacttcaagtccccacatccacatctgagaac
attgtttctagtacagcactgtatccttcagtaacagtttcagcaacttcagcctctgca
gggggcagtactgctaccccaggtcctaagcctccagctgtagtatctcagcaggcagca
ggcagcactactgtgggagccacattaacatcagtttctaccaccacttcattcccaagc
acagcttcacagctgtccattcagcttagcagcagtacttctactcctactttagctgaa
accgtggtagttagcgcacactcactagataagacatctcatagcagtacaactggattg
gctttctccctctctgcaccatcttcctcttcctctcctggagcaggagtgtctagttct
gtttctcagcctggtgggctgcatcctttggtcattccatcagtgatagcttctactcct
attcttccccaagcagcaggacctacttctacacctttattaccccaagtacctagtatc
ccacccttggtacaacctgttgccagtgtgcctgctgtacagcagacactaattcatagt
cagcctcaaccagctttgcttcccaaccagccccatactcattgtcctgaaatagattct
gatacacaacccaaagctcctggaattgatgacataaagactctagaagaaaagctgcgg
tctctcttcagtgaacacagctcatctggagctcagcatgcctctgtctcactggagacc
tcactagtcatagagagcactgtcacaccaggcatcccaactactgctgttgcaccaagc
aaactcctgacttctgccacaagtacttgcttaccaccaaccaatttaccactaggaaca
gttgctttgccagttacaccagtggttacacctgggcaagtttctaccccagtcagcact
actacatcaggactgaaacctggaactgctccctcaaagccacctctaaccaaggctccg
gtgctgccagtgggtactgaacttccagcaggtactctacccagcgagcagctgccacct
tttccaggaccttctctaacccagtcccagcaacctctagaggatcttgatgctcaattg
agaagaacacttagtccagagattatcacagtgacttctgcggttggtcctgtgcccgtg
gtggttccaacagcaattacagaagcaggagcacagcctcagaaggatgtttctcaagtc
aaagaaggccctgtcctagcaactagttcaggagctggtgtttttaagatgggacgattt
caggtttcagttgcagcagacgatgcccagaaagagggtaaaaataagtcagaagatgca
aagtctgttcattttgaatccagcacttcagagtcctcggtgctatcaagtagtagtcca
gagagtaccttggtgaaaccagagccgaatgggataaccatccctggtatctcttcagat
gtgccagagagtgcccacaaaactactgcctcagaggcaaagtcagacactgggcagcct
accaaggttggacgttttcaggtgacaactacagcaaagaaagtgggtcgtttctctgta
tcaaaaactgaggacaagatcactgacacaaagaaagaaggaccagtggcatctcctcct
tttatggatttggaacaagctgttcttcctgctgtgataccaaagaaagaaaagcctgaa
ctgtcagagccttcacatctaaatgggccatcttctgacctggaggccgcttttttaagt
agggatgtggatgatggttcaggtagtccacactccccccatcaactgagctcaaagagc
cttcctatccagaatctaagtcaaagccttagtaattcatttaactcctcttacatgagt
agtgacaatgagtcagatatcgaagatgaagacttaaagttagagctgcgacgactacga
gataaacatctcaaagagattcaggacctgcagagtcgccagaagcatgaaattgaatct
ttatataccaaactgggcaaggtgccccctgctgttattattcccccagctgctcccctt
tcagggagaagacgacgacccactaaaagcaaaggaagcaaatctagtcgaagcagttcc
ttggggaataaaagcccccagctttcaggtaacctgtctggtcagagtgcagcttcagtc
ttgcacccccagcagaccctccaccctcctggcaacatcccagagtccgggcagaatcag
ctgttacagccccttaagccatctccctccagtgacaacctctattcagccttcaccagt
gatggtgccatttcagtaccaagcctttctgctccaggccaagggaccagcagcacaaac
actgttggggcaacagtgaacagccaagccgcccagtctcagcctcctgccatgacgtcc
agcaggaagggtacattcacagatgacttgcacaagttggtagacaattgggcccgagat
gccatgaatctctcaggcaggagaggaagcagagggcacacaaattatgagggccctgga
atggcaaggaagttttctgcacctgggcaactgtgcatctccatgacctcaaacctgggt
ggctctgcccccatctctgcagcatcagctacctctctaggtcacttcaccaagtctatg
tgccccccacagcagtatggctttccagctaccccatttggcgctcagtggagtgggacg
ggtggcccagcaccacagccacttggccagttccaacctgtgggaactgcctccttgcag
aatttcaacatcagcaatttgcagaaatccatcagcaaccccccaggctccaacctgcgg
accacttag

DBGET integrated database retrieval system