KEGG   Pongo abelii (Sumatran orangutan): 100436442
Entry
100436442         CDS       T01416                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00100  Steroid biosynthesis
pon01100  Metabolic pathways
Module
pon_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100436442 (TM7SF2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100436442 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100436442
NCBI-ProteinID: XP_024110707
Ensembl: ENSPPYG00000003079
Position
11
AA seq 418 aa
MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPAYLPGLEALWSP
RALLLWLAWLGLQAALYLLPARKVAEGQELKDESRLRYPINGFQALVLTALLVGLGMSAG
LPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELN
PRICFFDFKYFCELRPGLIGWVLINMALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAILTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLHHPQSLGLPMASVICLINAIG
YYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccccactcagggcccgcgggccccgctggaattcggagggcccctgggcgccgcg
gctctgctgctgctgctgcccgccaccatgttccacctgctcctggcggcccgttcgggc
cccgcgcgcctgctgggtccacccgcgtacctgcctggactggaggcgctgtggagccca
cgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctctacctactgccg
gcgcgcaaggtggccgaggggcaggaattgaaggacgagagtcgcctgcgctatcctatt
aacggcttccaggccctggtgctgacagccctgttggtggggctggggatgtcagcgggg
ctgcctctgggggcgctcccggaaatgctcctgcccttggcgtttgtcgccaccctcacc
gctttcatcttcagcctctttctctacatgaaggcgcaggtagccccagtttcggccctg
gcacctgggggcaactcaggcaatccgatttacgacttttttctgggacgggagctcaac
cctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacctggcctcatcggc
tgggtcctcatcaacatggccctgttgatgaaggaggcagagcttcggggcagtccctca
ctggccatgtggctggtcaatggcttccagttactctacgtgggtgatgccctctggcat
gaggaggccatcctcaccaccatggatatcacacatgacgggtttggcttcatgctggcg
tttggggacatagcctgggtgcccttcacctacagcctgcaggcccagttcctgctgcac
cacccgcagtccctgggattgcccatggcctccgtcatctgcctcatcaatgctattggt
tactacatcttccgtggggcgaattcccagaaaaacactttccgaaagaatccttctgac
cccagagtggctgggcttgagaccatctctacagccacagggcggaaactgctggtgtct
gggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggct
tggtccttgccctgcggggtgtcacacctgctgccctacttctacctcctctacttcacc
gcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcagaagtacggcctg
gcctggcaggagtactgccggcgtgtgccttaccgcatcatgccctacatctactga

DBGET integrated database retrieval system