KEGG   Pongo abelii (Sumatran orangutan): 100437813Help
Entry
100437813         CDS       T01416                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyl-transferase 2 isoform X1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00514  Other types of O-glycan biosynthesis
pon00515  Mannose type O-glycan biosynthesis
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    100437813 (POMT2)
   00514 Other types of O-glycan biosynthesis
    100437813 (POMT2)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100437813 (POMT2)
Glycosyltransferases [BR:pon01003]
 O-Glycan biosynthesis
  O-linked Man type
   100437813 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT MIR PMT_4TMC
Motif
Other DBs
NCBI-GeneID: 100437813
NCBI-ProteinID: XP_009247607
Ensembl: ENSPPYG00000006020
Position
14
AA seq 848 aa AA seqDB search
MPPATGGGLAESKLRPRRGRCGPQAARAACRDVAAEAVARSPKRPARGSRRFEAAGWWAL
LALVTLLSFATRFHRLDEPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSWLVPFAYLTVLDLSKSLSAALLTAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGVSLAGAL
GVKFVGLFIILQVGLNTIADLWYLFGDLSLSLVTVGKHLTARVLCLIVLPLALYTATFAV
HFMVLSKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETS
RNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLV
TGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPE
MLLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFSGVNDTDFRVYLLGNPVVWWL
NLLSITLYLLSGSIIAVAMQRGARLPAEVAGPAARRRPGPARLDTPLLPVFPDGPGPLLP
PLLPSHALLKHVDRHSVGHPPAALCLGLGLVAPGQGHTRGGNPEPAPGNRLQLLPLPPSG
LRDGWSPGPGPPKSNGRTKVAGLMGLLRLLQRFQPGSRNFPVEPAGKQYWTHPAVRKLPK
EPQEFCCPPGPSSGSAAGMEPSIGESRERAAAPSTAPQRGQHLSGCSLVHSAGEDGCQRV
GVGARVCM
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggccacgggcggaggcctggcagagtccaagctgcgtccccggaggggccgc
tgtgggccccaggctgctagggccgcatgcagggacgtggccgctgaggctgtggcgcga
agccccaaacggcctgcccggggctcacggcgcttcgaggcggccggctggtgggctctg
ctggccttggtgacgctgctgtccttcgccacccgcttccaccgcttggatgagccgccg
cacatctgttgggatgagactcacttcggaaaaatgggaagttactatatcaaccgtaca
tttttctttgatgtgcacccacccctgggaaagatgctgataggtcttgctggctacctg
agtggatatgatggtacctttttgttccagaagcctggggataaatatgagcatcacagc
tacatgggaatgagaggattctgtgcattcctcggctcctggctggtcccctttgcctac
ctcactgtactggatctgtccaagtccctctcggcagcactgctcaccgctgccctcctc
acctttgacacgggatgcctcactctgtcccagtacatcctccttgaccccatcctgatg
ttcttcatcatggctgccatgctgagcatggttaagtacaactcctgtgccgacaggccc
ttctctgccccctggtggttctggctcagcctgactggcgttagtcttgctggtgcttta
ggggtcaagtttgttggcctctttatcatccttcaagtggggctgaacaccattgcagac
ctttggtacctgttcggagacctcagtctttcattggtgactgtgggaaaacacctgact
gctcgtgtcctgtgcctcatagtgctgcccctggctctctacacagccacctttgctgtt
cacttcatggtgctgagtaaaagtggccctggtgacggtttcttcagttctgccttccag
gcccggctctcagggaacaacctgcacaatgcttccatccctgaacacctggcctacggc
tctgtgatcactgtgaagaacctccggatggccatcggctatctgcactcccacaggcac
ctctaccccgagggcattggtgcccgtcagcagcaggtcaccacctatttgcacaaggac
tacaacaacctgtggattatcaagaaacataacacaaactcagatcccctagacccttcc
ttcccagtggagtttgtaagacatggagacattattcgactagaacacaaagaaacttcc
cggaacttgcacagtcactatcatgaggcccccctgacccggaagcactatcaggtcacc
ggctatggcataaatggaacaggggactcaaatgatttctggcggattgaggtcgtaaac
agaaaatttggaaaccggatcaaagtgctgagaagtcgaattcgcttcatccatttggtc
acaggttgtgtcctgggctcctcaggaaaggttctgcccaagtggggctgggagcagttg
gaagttacttgcaccccatacctgaaagaaaccctcaactccatctggaatgtggaggac
catatcaatcccaagttgccaaacatcagcttggatgtgctgcagcccagttttcctgag
atgttgctggaatcccacatggtcatgatccgggggaacagtggcctcaaacccaaggac
aatgagttcacgtccaaaccctggcactggcctatcaactatcagggcctacgcttctca
ggggtcaatgacacagatttccgagtctatctgcttggcaacccggtggtttggtggctc
aatctgttgagcatcaccctctacctcctctcagggagcatcattgctgtagccatgcag
agaggggcacggctgccagcggaggttgcaggtcctgctgcgaggaggcggccaggtcct
gctcggctggacactccattacttcccgtttttcctgatgggccgggtcctctacttcca
ccactacttcccagccatgctcttctcaagcatgttgacaggcattctgtgggacaccct
cctgcggctctgtgcctggggcttggcctcgtggcccctggccaggggcatacacgtggc
gggaatcctgagcctgctcctgggaaccgcctacagcttctacctcttccaccctctggc
ttacgggatggttggtcccctggcccaggacccccaaagtccaatggcaggactaaggtg
gctggactcatgggacttttgaggctactgcaaagattccagcctgggtccaggaacttc
ccagtagagccagctgggaagcagtactggacccatccagccgtgaggaagctgcctaag
gagccccaagaattctgctgcccaccaggacccagctctgggagtgcagctggaatggaa
cccagcattggagagagccgggagagagccgcagctccatccacagcaccacagagagga
cagcacctctcgggctgctcccttgtgcacagcgcaggggaggatgggtgccagagggtg
ggagtgggtgcgcgtgtgtgtatgtga

DBGET integrated database retrieval system