KEGG   Pongo abelii (Sumatran orangutan): 100438599Help
Entry
100438599         CDS       T01416                                 

Gene name
HEXB
Definition
(RefSeq) beta-hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00511  Other glycan degradation
pon00520  Amino sugar and nucleotide sugar metabolism
pon00531  Glycosaminoglycan degradation
pon00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pon00604  Glycosphingolipid biosynthesis - ganglio series
pon01100  Metabolic pathways
pon04142  Lysosome
Module
pon_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100438599 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100438599 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100438599 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100438599 (HEXB)
   00511 Other glycan degradation
    100438599 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100438599 (HEXB)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100438599 (HEXB)
Chaperones and folding catalysts [BR:pon03110]
 Intramolecular chaperones
  Others
   100438599 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100438599
NCBI-ProteinID: XP_009239080
Position
5
AA seq 556 aa AA seqDB search
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPGVWAKPRPALWPQP
LSVKMTPNLLHLSPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQA
RTQLQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSYGTFTINESTIIDSPRFPHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSIAFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTRFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQEQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYERLTRHRCRMVERG
IAAQPLYAGYCNHENM
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgcgggctggggctgccccggccgcccatgctgctggcgctgctgttggcg
acactgctggcggcgatgttggcgctgctgactcaggtggctctggtggtgcaggtggcg
gaggcggctcgggccccgggcgtctgggccaagccgaggccggcgctgtggccccagccg
ctctcggtgaagatgaccccgaacctgctgcatctctccccggagaacttctacatcagc
cacagccccaattccacggcgggcccctcctgcaccctgctggaggaagcgtttcggaga
tatcatggctatatttttggtttctacaagtggcatcatgaacctgctgaattccaggct
agaacccagcttcagcaacttcttgtctcaatcacccttcagtcagagtgtgatgctttc
cccaacatatcttcagatgagtcttatactttacttgtgaaagaaccagtggctgtcctt
aaggccaacagagtttggggagcattacgaggtttagagacctttagccagttagtttat
caagattcttatggaactttcaccatcaatgaatccaccattattgattctccaaggttt
cctcacagaggaattttgattgatacatccagacattatctgccagttaagattattctt
aaaactctggatgccatggcttttaataagtttaatgttcttcactggcacatagttgat
gaccagtctttcccgtatcagagcatcgcttttcctgagttaagcaataaaggaagctat
tctttgtctcatgtttatacaccaaatgatgtccgtatggtgattgaatatgccagatta
cgaggaattcgagtcctgccagaatttgatacccctgggcatacactatcttggggaaaa
ggtcagaaagacctcctgactccgtgttacagtagacaaaacaagttggactcttttgga
cctataaaccctactctgaatacaacatacagcttccttactagatttttcaaagaaatt
agtgaggtgtttccagatcaattcattcatttgggaggagatgaagtggaatttaaatgt
tgggaatcaaatccaaaaattcaagatttcatgaggcaaaaaggctttggcacagatttt
aaaaaactagaatctttctacattcaaaaggttttggatattattgcaaccataaacaag
ggatccattgtctggcaggaggttttcgatgataaagcgaagcttgcaccgggcacaata
gttgaagtatggaaagacagcgcgtatcctgaggaactcagtagagtcacggcgtctggc
ttccctgtaatcctttctgctccttggtacttagatttgattagttatggacaagattgg
aggaaatactataaagtggaacctcttgattttggtggtactcaggaacagaaacaactt
ttcattggtggagaagcttgtctatggggagaatatgtggatgcaactaacctcactcca
agattatggcctcgggcaagtgctgttggtgagagactctggagttccaaagatgtcaga
gatatggatgacgcctatgagagactgacaaggcaccgctgcaggatggtcgaacgtgga
atagctgcacaacctctttatgctggatattgtaaccatgagaacatgtaa

DBGET integrated database retrieval system