KEGG   Pongo abelii (Sumatran orangutan): 100438722Help
Entry
100438722         CDS       T01416                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine-5'-phosphatase isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100438722 (PUDP)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     100438722 (PUDP)
Protein phosphatases and associated proteins [BR:pon01009]
 HAD phosphatases
  Other HAD phosphatases
   100438722 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 100438722
NCBI-ProteinID: XP_002831404
Ensembl: ENSPPYG00000020105
UniProt: H2PUV1
Position
X
AA seq 229 aa AA seqDB search
MAAPPPQPVTHLIFDMDGLLLDTEQLYSVVFQEICDRYDKKYSWDVKSLVMGKKALEAAQ
IIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSAS
FEMKTSHHQEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPN
GVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPPYE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccccgccgcagcccgtcacccacctcatctttgacatggacggacttctt
ctggatactgaacagctgtattcagtggtgtttcaagaaatatgtgatcgctatgacaag
aaatacagctgggatgtaaagtccctggttatgggtaagaaggcattagaggcggcacag
attataatagacgtcttgcagctcccaatgtccaaagaggagctggtggaagaaagccaa
acaaagttaaaggaagtgttccccacggctgcgctcatgccaggggctgagaaactcatc
atccacctgcggaaacacggcatcccctttgcgctggccaccagctcggggtccgcatcg
ttcgagatgaagacgagccaccaccaggagttcttcagcttgttttcccacattgtgctg
ggagatgaccccgaagtgcagcatggcaagccagacccagacatcttcctagcttgtgcc
aagaggttctctccccctcctgctatggaaaagtgccttgtctttgaagatgctcccaac
ggggtagaggcggccctggcagctgggatgcaggtggtcatggttcctgacggaaacttg
agccgagatctgacgacgaaggccaccctggtgctgaattccctgcaggacttccagccc
gagctgtttggtttgcccccctatgagtga

DBGET integrated database retrieval system