KEGG   Pongo abelii (Sumatran orangutan): 100441366Help
Entry
100441366         CDS       T01416                                 

Gene name
ADSSL1
Definition
(RefSeq) adenylosuccinate synthetase isozyme 1 isoform X2
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon00250  Alanine, aspartate and glutamate metabolism
pon01100  Metabolic pathways
Module
pon_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100441366 (ADSSL1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100441366 (ADSSL1)
Enzymes [BR:pon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     100441366 (ADSSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt hSac2 MBF1 DUF5442
Motif
Other DBs
NCBI-GeneID: 100441366
NCBI-ProteinID: XP_002825203
Ensembl: ENSPPYG00000006190
UniProt: H2NME3
Position
14
AA seq 457 aa AA seqDB search
MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADII
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGL
RICDLLSDFDEFSSRFKNLAHQHQSMFPTLEIDIEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQTRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDVLGEIKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE
DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacccgagcctccaacgaccggccccccggcgcaggcggcgtcaagcggggg
aggctgcaacaggaggcggcggcgaccggctcccgcgtgacggtggtgctgggcgcgcag
tggggggacgagggcaaaggcaaggtggtggacctgctggccacggacgccgacatcatc
agccgctgccaggggggcaacaacgccggccacacggtggtggtggatgggaaggagtac
gacttccacctgctgcccagcggcatcatcaacaccaaggccgtgtccttcattggcaac
ggggtggtcattcacttgccaggcttgtttgaggaagcagagaagaatgaaaagaaaggc
ctgaaggactgggagaagaggctcatcatctctgacagagctcaccttgtgtttgatttt
caccaggctgtcgacggacttcaggaagtgcaacgccaggcacaagaggggaagaatata
ggcaccaccaagaagggaatcggaccaacctactcttccaaagctgcccggacgggcctc
cgcatctgcgacctcctgtcagattttgatgagttttcctccagattcaagaacctggcc
caccagcaccagtcgatgttccccaccctggaaatagacattgaaggccaactcaaaaga
ctcaagggctttgctgagcggatcagacccatggtccgagatggtgtttactttatgtat
gaggcactccacggcccccccaagaagatcctggtggagggtgccaacgccgccctcctc
gacattgacttcgggacctacccctttgtgacttcatccaactgcaccgtgggcggcgtg
tgcacgggcctgggcatccccccacagaacataggtgacgtgtatggcgtggtgaaagcc
tataccacacgcgtgggcatcggggccttccccactgaacagattaacgagattggagac
ctgctgcagacccgcggtcacgagtggggagtgaccacaggcaggaagaggcgctgtggc
tggctcgacctgatgattctgagatatgctcacatggtcaacggattcactgcgctggcc
ctgacgaagctggacatcctggacgtactgggtgagattaaagtcggcgtctcatacaag
ctgaacgggaaaaggattccctatttcccagctaaccaggagatgcttcagaaggtcgaa
gtcgaatatgaaacgctgcctggctggaaagcagacaccacaggcgccaggaggtgggag
gacctgcccccgcaggcccagaactacatccgctttgtggagaatcacgtgggagtcgca
gtcaaatgggttggtgttggcaagtcaagagagtcgatgatccagctgttttag

DBGET integrated database retrieval system