KEGG   Pongo abelii (Sumatran orangutan): 100442337Help
Entry
100442337         CDS       T01416                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100442337 (DOCK7)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100442337 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N Elong_Iki1 TEA
Motif
Other DBs
NCBI-GeneID: 100442337
NCBI-ProteinID: XP_009247844
Ensembl: ENSPPYG00000001280
Position
1
AA seq 2098 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYSGSPQLLKNLNLVGNISHHTTVPLTEAVDPVDL
EDYLITHPLAVDSGPLRDLIEFPPDDIEVVYSPRDCRTLVSAVPEESEMDPHVRDCIRSY
TEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDDQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKSNRHKELFALHP
SPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVIRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHG
RNSLLASYIHYVFRLPNTYPNSSSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKAMDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELAL
QWVVCSGSVRESALQQAWFFFELMVKSMVHHLYFNDKLDAPRKSRFPERFMDDIAALVST
IASDIVSRFQKDTEMVERLNTSLAFFLNDLLSVMDRGFVFSLIKSCYKQVSSKLYSLPNP
SVLVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIA
NMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYSD
PQIKARVAMLYLPLIGIIMETVPQLYDFTETHNQRGRPICIATDDYESESGSMISQTVAM
AIAGTSVPQLTRPGSFLLTSTSGRQHTTFSAESSRSLLICLLWVLKNADETVLQKWFTDL
SVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMV
RRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEAN
LIILDTLEIVVQTVSVTESKESILGGVLKVLLHSMACNQSAVYLQHCFATQRALVSKFPE
LLFEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMS
LSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMK
EHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAE
YLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQ
AAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTY
FRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKC
KLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFK
RKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQ
MVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSL
IGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcccagaagatcagcagaacggtggcagctgaggttagg
aagcagatctccggacaatatagtggttctccccaactgctcaaaaaccttaatcttgtt
ggcaatatatcccatcacaccacagtgccccttactgaagcagtagatccagtggatttg
gaagattacctcattactcatcctttggctgtggattctgggcctttacgggatttgatt
gaatttcctccagatgatattgaagttgtttatagtcctcgggactgcagaactcttgtt
tcagctgtacctgaagaaagtgaaatggatccacatgttagagactgtataagaagttat
acagaagactgggcaattgtcatcagaaaatatcataaattgggaacaggatttaatccc
aatacattagataaacagaaagaaaggcaaaaaggtttgccaaaacaagtttttgaatct
gatgaagctccagatggcaacagctaccaggatgatcaagatgaccttaaaagacgttca
atgtcaatagatgataccccaaggggtagctgggcttgtagtatctttgacttgaaaaat
tcacttcctgatgctttgcttcccaatttacttgatcgaactccaaatgaagaaatagac
cgccagaatgatgaccaaaggaaatcaaaccgtcacaaagaactttttgctttgcatcca
tcaccagatgaggaagaaccaatagaacggcttagtgttcctgatgtacccaaagaacat
tttggtcaaagacttcttgtaaagtgcttatcactcaagtttgaaattgaaattgaaccc
atttttgcaagtttggctttatatgatgtcaaggaaaagaaaaagatttcagaaaacttt
tattttgaccttaattctgagcagatgaaaggattgttacgtccacatgtaccacctgct
gccattaccaccctggcaagatcagcaattttttctatcacttatccttcccaagatgtt
tttcttgtaataaagctagaaaaagtcctacagcaaggagacattggagagtgtgcagaa
ccatatatgattttcaaagaagcagatgccaccaagaataaagaaaaactggagaaactg
aagagtcaagcagatcagttttgccaaagacttgggaaatatcgcatgccttttgcttgg
actgcaatccatttaatgaatattgttagcagtgctgggagtttggaaagagattctaca
gaagtagaaatcagtactggagaacgaaaagggtcttggtcagagaggaggaattctagt
attgtcggcagacgatcacttgaaaggacaacaagtggagatgatgcttgtaacttgacg
agctttcgaccagctactctcacagtgacaaatttttttaagcaggaaggagaccgctta
agtgatgaagatctctacaaattccttgctgatatgagaaggccatcttctgtcttacgg
cgactaagacctattacagctcagctcaagatagacatttctcccgcacccgaaaatccc
cattattgcctaactccggagctgcttcaagtgaagctttaccctgacagtagagttaga
cctaccagagaaatcttagagtttcccgcaagggatgtttatgttccaaacactacttac
agaaatcttctctacatataccctcagagtcttaattttgccaatcgtcaaggttctgct
agaaatataacagtgaaagtccagtttatgtatggagaggatccaagcaatgccatgccg
gtaatctttggtaaatctagctgttcagaattttcaaaggaagcctatacagccgtagta
tatcataacaggtctcctgattttcatgaagaaatcaaggttaagcttcctgctacttta
actgaccatcatcacttgctttttactttttatcatgttagttgtcaacaaaaacaaaat
actcctcttgaaacaccagttggatatacatggataccaatgcttcagaatggacggttg
aagactggccagttttgcttgccagtctcattggaaaaaccaccacaggcttactctgta
ctgtctcctgaggttcctcttcctggcatgaaatgggtagataatcacaaaggtgttttt
aatgttgaagttgttgctgtttcatctatccatacacaagatccttatcttgacaaattt
tttgctctggtcaatgctctggatgaacacatgttcccagtccgaattggggacatgcga
atcatggaaaataacttagaaaatgaattgaagagcagtatttcagcactgaattcatcc
cagttggaaccagtggtccgatttcttcatcttctgctagataaactgatacttttagtt
attagacctcctgtcattgctggccaaatagttaacctaggtcaagcatcttttgaagcc
atggcatcaattataaatcgacttcacaaaaacttggaaggaaatcatgaccagcatggc
agaaacagccttcttgcatcatatattcattatgttttccgcctaccaaatacttaccct
aattcatcatcaccaggtcctgggggtttgggaggatcagtgcattatgccacaatggct
agatctgcggtgagacctgcaagccttaatttaaatcgttctcgaagccttagtaatagc
aatccagatatatctgggactcccacgtcaccagatgatgaagttcgatcaatcatcggg
agtaaggctatggatcgaagttgtaatcgtatgtcttcgcacacagagacgtcaagtttc
ttacaaacattaacgggacgcttaccaactaaaaagctttttcatgaggagctggctttg
cagtgggttgtttgcagtggcagcgttcgggaatcagctttgcaacaagcctggttcttt
tttgaattaatggtaaagagcatggtgcaccatttatactttaatgataaacttgatgct
ccaaggaaaagtcgttttccagaacgtttcatggatgacattgcagctcttgtcagcacg
attgctagtgatatagtttcacgatttcagaaggacacagaaatggttgagagactcaat
acaagccttgcattctttctcaatgatctgttgtctgttatggacagaggatttgttttt
agccttataaagtcctgctataaacaggtgtcttcaaagctttactcattaccgaatccg
agtgttctggtgtccttgaggctggattttctacgaatcatctgcagtcatgagcactat
gttacattaaacttaccctgcagcttacttactccacctgcatctccatcaccttctgtt
tcttctgcaacatctcagagttctggattttctacgaatgtacaagaccaaaagattgca
aatatgtttgaattgtccgtgcctttccgccaacaacattatttggcaggacttgtgtta
acagagctggctgtcattttagaccctgatgctgaaggactgtttggattgcataagaaa
gtcatcaatatggtacacaatttactctccagtcacgactcagacccgcggtactctgac
cctcagataaaggctcgagtggccatgttgtatctacctttgattggtattatcatggaa
actgtacctcagctgtatgattttacagaaactcacaatcaacgaggaagaccaatttgt
atagctactgatgattatgaaagtgagagcggaagtatgataagccagaccgttgccatg
gcaatcgcagggacatcggtccctcaactaacaaggcctggcagtttcctcctcacgtca
acgagtggcagacaacacactaccttttcagcagaatcaagtcgaagccttttgatctgt
ctactttgggttctcaaaaatgcagatgaaacagttctacagaagtggtttacggatctc
tcagtcttgcagctaaaccggctattagatctgctttatctctgtgtgtcttgctttgag
tataaagggaaaaaagtgtttgaacgaatgaatagcttgacctttaagaaatcaaaagac
atgagagcaaagcttgaagaagctattcttgggagcataggtgccaggcaagaaatggta
cgccgaagccgaggacagctcgagagaagcccatctggaagtgcctttggaagtcaagaa
aatttgaggtggagaaaagatatgactcactggcgtcaaaacacagagaagcttgataaa
tcaagagcagagattgaacacgaagcactgattgatggaaacctggctacagaagcaaac
ctaatcattttagatacattagagattgttgttcagaccgtttctgtaacggaatccaaa
gagagcattcttggtggagtgctaaaagtgctactacacagcatggcctgtaaccaaagt
gcagtttatctacaacactgttttgctacacagagagccttggtttcaaagtttcctgaa
ctcttatttgaagaagagacagagcagtgtgctgatttatgcctcaggcttctccgacac
tgtagcagtagcatcagtacaatacggtcacacgccagtgcctccctttacctactaatg
aggcaaaactttgagattgggaataactttgccagggttaaaatgcaggtaacaatgtca
ctgtcctccttggtgggcacatctcagaattttaatgaagaattcttaagacgttctcta
aagactatattgacatatgctgaagaagatctggaattgagggaaacaacatttcctgat
caggtccaggatctggttttcaatctccatatgattctttctgatactgtgaaaatgaag
gaacatcaggaggatcctgaaatgttgattgatctaatgtacagaattgccaagggttac
cagacctctccagatctgcgattgacctggttgcagaacatggctggcaagcactcagaa
cgaagcaatcatgctgaagctgcacagtgtctagtccactcagcagcacttgttgctgaa
tatttgagcatgctggaggaccggaaatatcttcctgtgggatgtgtaacatttcagaat
atttcatctaatgttttagaagaatctgcggtctcagatgatgtggtatctccagatgaa
gaaggtatctgctctggaaaatactttactgagtcaggacttgtgggattactggaacaa
gcagctgcttccttctctatggctggcatgtatgaagcagttaatgaggtttacaaagta
cttattcctattcatgaagctaatcgggatgcaaagaaactatccacaattcatggtaaa
cttcaagaagcattcagcaaaattgttcatcaggatggtaagcggatgtttggcacctat
tttcgtgttggtttttatggaaccaagttcggggatttggatgaacaagaatttgtttac
aaggagcctgcaataaccaaacttgcagagatatctcacagattggagggattttatgga
gaaagatttggagaggatgtggttgaagtaatcaaagactctaatcctgtagacaagtgt
aaattagatcctaacaaggcatatattcagattacctatgtggagccatactttgacaca
tatgagatgaaggacagaatcacctatttcgacaaaaattataatcttcgccgattcatg
tactgtacaccctttactttagatggccgtgcccatggggaacttcatgaacaattcaaa
aggaagaccattctgactacgtctcatgcctttccttatattaaaacaagggtcaatgtc
actcataaagaagagatcatcttaacaccaattgaagttgctattgaggacatgcagaaa
aagacacaggagttggcatttgcaacacatcaggatcccgcagaccccaaaatgcttcag
atggtactccagggatctgtaggcacaacagtgaatcaggggcctttggaagttgcccag
gtttttctgtctgaaatacctagtgacccaaaactcttcagacatcataataaactgcga
ctctgctttaaagattttactaaaaggtgtgaagatgccttaagaaaaaataagagctta
attgggccggatcaaaaggagtatcaaagggaactggagagaaactatcatcgccttaaa
gaggccctacagccactgatcaacagaaagatccctcagttatacaaggcagtattgcct
gtcacctgccacagagattcctttagtcgaatgagccttcgcaaaatggatctctaa

DBGET integrated database retrieval system