KEGG   Pongo abelii (Sumatran orangutan): 100443314Help
Entry
100443314         CDS       T01416                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X2
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04530  Tight junction
pon04660  T cell receptor signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing's syndrome
pon05161  Hepatitis B
pon05162  Measles
pon05165  Human papillomavirus infection
pon05166  HTLV-I infection
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05212  Pancreatic cancer
pon05214  Glioma
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
Module
pon_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100443314 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100443314 (CDK4)
   04115 p53 signaling pathway
    100443314 (CDK4)
   04218 Cellular senescence
    100443314 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    100443314 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100443314 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100443314 (CDK4)
   05203 Viral carcinogenesis
    100443314 (CDK4)
   05212 Pancreatic cancer
    100443314 (CDK4)
   05225 Hepatocellular carcinoma
    100443314 (CDK4)
   05214 Glioma
    100443314 (CDK4)
   05220 Chronic myeloid leukemia
    100443314 (CDK4)
   05218 Melanoma
    100443314 (CDK4)
   05219 Bladder cancer
    100443314 (CDK4)
   05224 Breast cancer
    100443314 (CDK4)
   05222 Small cell lung cancer
    100443314 (CDK4)
   05223 Non-small cell lung cancer
    100443314 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100443314 (CDK4)
   04934 Cushing's syndrome
    100443314 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    100443314 (CDK4)
   05162 Measles
    100443314 (CDK4)
   05161 Hepatitis B
    100443314 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100443314 (CDK4)
   05165 Human papillomavirus infection
    100443314 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    100443314 (CDK4)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100443314 (CDK4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100443314 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100443314
NCBI-ProteinID: XP_002823486
Ensembl: ENSPPYG00000004703
UniProt: A0A2J8UGT3
Position
12
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacgtatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcgcagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system