KEGG   Pongo abelii (Sumatran orangutan): 100443993Help
Entry
100443993         CDS       T01416                                 

Gene name
MTMR1
Definition
(RefSeq) myotubularin-related protein 1 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100443993 (MTMR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100443993 (MTMR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100443993 (MTMR1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100443993 (MTMR1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100443993 (MTMR1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100443993 (MTMR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc 3-PAP Y_phosphatase Y_phosphatase3 Myb_CC_LHEQLE
Motif
Other DBs
NCBI-GeneID: 100443993
NCBI-ProteinID: XP_009233642
Ensembl: ENSPPYG00000020816
Position
X
AA seq 685 aa AA seqDB search
MDRPAAAAAVAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEW
CKQLIAATISSQISGSVTSENVSRDYKVFRRPDIRNIHKARQRLALRDGNKLAQMEEAPL
FPGESIKAIVKDVMYICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKI
GAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALFAFSYKE
KFPINGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVA
AFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIF
DARQNSVADTNKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARW
LSNVDGTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYY
RTIKGFETLVEKEWISFGHRFALRLGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFE
FNELFLITILDHLYSCLFGTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNY
ENHVLYPVASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEGLQREVA
TRAVSSSSERGSSPSHSATSVHTSV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggacaggccggcggcggcggcggcagtggcggcggcgggctgcgagggcggcgggggc
ccgaacccggggccggcgggcggcaggaggcctcctcgggccgcggggggcgccaccgcc
ggctcccggcagcccagcgtggagaccctggacagtcccacaggatcacatgttgaatgg
tgtaaacagcttatagctgctacaatttctagtcagatttcaggttcagtgacatcagaa
aatgtatccagagattacaaggttttcaggaggcctgatataaggaacattcataaagca
agacaaagattggctctaagggatggaaataagctggcacagatggaagaggctccactt
ttcccaggagaatcaattaaagccattgtgaaagatgtcatgtatatctgcccatttatg
ggagcagtgagtggaacgctgacagtgacggactttaagctgtacttcaaaaatgtcgag
agggacccgcattttatccttgatgttccccttggagtgatcagcagagttgagaagatt
ggagcacagagccacggagacaattcctgtggtatagagatagtgtgcaaggatatgagg
aacttgcggcttgcttataaacaggaagaacagagtaaactagggatatttgaaaacctc
aataaacatgcatttcctctttctaacggacaggcactatttgcattcagctataaagaa
aaatttccaattaatggctggaaagtttatgatccagtatctgaatataagagacagggc
ttgccaaatgagagttggaaaatatccaaaataaacagtaattatgagttctgtgacacc
taccctgccatcattgttgtgccaactagtgtaaaagatgatgacctttcaaaagtggca
gcttttcgagcaaaaggcagagtccctgtgttgtcatggattcatccggaaagtcaagca
acgattacccgttgcagccagccacttgtgggtcccaatgataagcgctgcaaagaggat
gaaaaatacttgcaaacaataatggatgctaacgcacagtcacacaagcttatcatcttt
gatgctcgacaaaacagtgtcgctgataccaacaagacaaagggtggaggatatgaaagt
gaaagtgcttacccaaacgcagaacttgtgttcttggaaatccacaacattcatgtcatg
cgagagtcactacgcaaattaaaagagattgtgtacccttcgatcgatgaggcacggtgg
ctctccaatgtggatgggacacattggctggaatatataaggatgctgcttgctggggca
gtaagaattgctgataaaatagaatctgggaaaacatctgtggtggtgcattgcagcgac
ggttgggaccgaacagcccagctcacatctctggctatgctaatgttggacagttactac
aggaccattaaaggatttgaaactctcgtagaaaaggagtggataagctttggacacagg
tttgcactgcgactgggccatggtaatgacaaccatgcggatgctgaccgatctcctata
tttctgcagtttattgattgtgtttggcaaatgacaagacagtttccttcagcattcgag
tttaatgagctattcttgattacaattttggatcacctttatagctgtctttttgggacc
tttttgtgcaactgtgaacagcagcgattcaaagaggatgtatatacaaagacgatatct
ttatggtcgtatatcaatagccagctagacgagttttctaatcccttctttgtgaattac
gaaaaccacgtgttatatcctgttgccagtctgagtcatttggaattgtgggtaaactat
tatgtgcgatggaatccacggatgagacctcagatgcccattcaccagaatctcaaggag
ctgctggccgtcagggcggagctgcagaagcgtgtggagggcctacagcgggaggtggcc
acgcgcgccgtctcatcctcatctgagcggggctcctcgccctcccactccgccacctcc
gtccacacctcggtctga

DBGET integrated database retrieval system