KEGG   Pongo abelii (Sumatran orangutan): 100445135Help
Entry
100445135         CDS       T01416                                 

Gene name
ARG2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00220  Arginine biosynthesis
pon00330  Arginine and proline metabolism
pon01100  Metabolic pathways
pon01230  Biosynthesis of amino acids
pon05146  Amoebiasis
Module
pon_M00029  Urea cycle
pon_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100445135 (ARG2)
   00330 Arginine and proline metabolism
    100445135 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100445135 (ARG2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100445135 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100445135
NCBI-ProteinID: XP_002824914
Ensembl: ENSPPYG00000005926
Position
14
AA seq 355 aa AA seqDB search
MMSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLS
SLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGD
HSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLP
GFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLI
GKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNP
QLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccctaaggggcagcctctcgcgcctactccagacgcgagtgcattccatcctg
aagaaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaaga
aaaggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctcc
agtttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagat
gatctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactg
gctgaggtggttagcagagctgtgtcggatggctacagctgtgtcacactgggaggagac
cacagcctggcaatcggtaccattagtggccatgcccgacactgcccagacctttgcgtt
gtctgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctc
catggacagccagtttcatttctcctcagagaactacaggataaggtaccacaactccca
ggattttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgaga
gacgtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatg
agagatattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgatt
ggcaagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactg
gctccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatatt
gctgaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcct
cagttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgatt
gcttcaagttttggtcagacaagagaaggagggcatattgtctatgaccaacttcctact
cccagttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system