KEGG   Pongo abelii (Sumatran orangutan): 100445423Help
Entry
100445423         CDS       T01416                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00040  Pentose and glucuronate interconversions
pon00053  Ascorbate and aldarate metabolism
pon00140  Steroid hormone biosynthesis
pon00830  Retinol metabolism
pon00860  Porphyrin and chlorophyll metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Module
pon_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100445423
   00053 Ascorbate and aldarate metabolism
    100445423
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100445423
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100445423
   00860 Porphyrin and chlorophyll metabolism
    100445423
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100445423
   00982 Drug metabolism - cytochrome P450
    100445423
   00983 Drug metabolism - other enzymes
    100445423
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100445423
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100445423
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100445423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4 DUF5412
Motif
Other DBs
NCBI-GeneID: 100445423
NCBI-ProteinID: XP_002814855
Position
4
AA seq 529 aa AA seqDB search
MSTKWTSVFLLIQLSCYIISGSCGKVLVWPTEFSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNSPSTLKLEVYPVSLTKTEFEDIFMQLVKRWADLPKDTFWSYFSQVQEIMWTFN
DIIRKFCKDAISNKKLMKKLQESKFDVVLADAIIPCGELLAELFNIPFVYSLRFSAGYTI
EKHSGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYVVYFQFWFQIFNMKKWDQFYSEVL
RRPTTLSETMGKADIWLIRNSWDFQFPHPLLPNVAFVGGLHCKPAKPLPKEMEEFVQSSG
QNGVVVFSLGSMFSNMTEERANVIASALAKIPQKVLWRFDGNKPHTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGSNGIYEAIYHGIPVVGIPLLADQPDNIAHMKAKGAAIRLDFNTM
SSTDLLNALKTVINDPLYKENAIKLSRIYHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCCMFCFLKFARTGKKGKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgaaatggacttcagtttttctcctgatacagctgagctgttatattatctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccattggatgaatatgaag
acaatcctggaggagcttgtccagaggggtcatgaggtgactgtattggcatcttcagct
tccattctttttgatccaaacagcccatctactcttaaacttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatatcttcatgcaactggtcaagagatgggcagacctt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacataattagaaagttctgtaaggatgcaatttcaaataagaaacttatgaaaaaacta
caagagtcaaaatttgatgttgttcttgcagacgctattattccctgtggggaactgctg
gctgagctatttaacataccctttgtgtacagtctccgtttctctgctggctacacaatt
gaaaagcatagtggaggatttctgtttccaccttcctatgtacctgttgttatgtcagaa
ctaagtgaccaaatgactttcatggagagggtaaaaaatatgatctatgtggtttatttt
caattttggttccaaatatttaatatgaagaagtgggatcagttttacagtgaagttcta
agaagacccactaccttatctgagacaatggggaaagctgacatatggcttattcggaac
tcctgggattttcagtttcctcatccactcttaccaaatgttgcttttgttggaggactc
cactgcaaacctgccaaacccctccctaaggaaatggaagagtttgtccagagctctgga
caaaatggtgttgtggtgttttcactggggtcaatgttcagtaacatgacagaagaaagg
gctaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccacatactttaggactcaatactcggttgtacaagtggataccccagaat
gaccttcttggtcatccaaaaaccagggcttttataactcatggtggatccaatggcatc
tacgaggcgatctaccatgggatccctgtggtgggcattccattgttagcggatcaacct
gataacattgcacacatgaaggccaagggagcagctattagactggacttcaacacaatg
tcgagtacagacttgctcaatgcactgaagacagtaattaatgaccctttatataaagag
aacgctataaagttatcaagaatttatcatgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatatttatcatcacaaagtgttgtatgttttgtttcttgaaatttgct
agaactggaaagaagggaaaaagagattag

DBGET integrated database retrieval system