KEGG   Pongo abelii (Sumatran orangutan): 100445948Help
Entry
100445948         CDS       T01416                                 

Definition
(RefSeq) histone H2B type 1-like
  KO
K11252  histone H2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05203  Viral carcinogenesis
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100445948
  Immune diseases
   05322 Systemic lupus erythematosus
    100445948
  Substance dependence
   05034 Alcoholism
    100445948
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100445948
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100445948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100445948
NCBI-ProteinID: XP_002816580
Ensembl: ENSPPYG00000016326
UniProt: A0A0A0MXS0
Position
6
AA seq 128 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNQL
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagtcagctcctgccccgaagaagggctccaagaaggcggtgacc
aaggcacagaagaaggacggcaaaaagcgcaagcgcagccgcaaggagagctattccgtg
tatgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggctatg
gggattatgaactccttcgtcaacgacatttttgagcgcattgcaggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacttccagggagatccaaacggctgtgcgc
ctgctgctacccggggagctggccaaacacgcggtgtcggagggcaccaaggctgtcacc
aagtacaccagctccaatcagctgtga

DBGET integrated database retrieval system