KEGG   Pongo abelii (Sumatran orangutan): 100447321Help
Entry
100447321         CDS       T01416                                 

Gene name
NUP205
Definition
(RefSeq) nuclear pore complex protein Nup205 isoform X1
  KO
K14310  nuclear pore complex protein Nup205
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
Module
pon_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100447321 (NUP205)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100447321 (NUP205)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100447321 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 100447321
NCBI-ProteinID: XP_024105652
Ensembl: ENSPPYG00000018027
Position
7
AA seq 2017 aa AA seqDB search
MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLVKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPL
LTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTGELIVALAEFTEA
DEAMAELAIADNVFLFLTESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRAD
EDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTI
MGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLK
VNGSSHVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQD
GLIAFLQLTSTIVTWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGK
SPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLV
ESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRD
YEPQLEDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAP
FPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADN
VVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECL
DCEDAEEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPV
STTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSD
TSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSH
TQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEI
PEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLL
MEEISTVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDIL
QDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKQTSVLGPAEAHYAFMLDSCF
TSPPPEENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRP
DEPDTLEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRML
ALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYES
KMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDR
YRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELAL
LTGIISKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQD
DNVEGDKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGP
RQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELC
QSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHC
MPTDSQDSLFASRTLFKSRRLQDSFASDTHLDFRSALAIVSQHDLDQLQADAINAFGESL
QKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6054 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctttggcggtaaattcggctgctagtctatggggtccttacaaagacatt
tggcataaagtgggaaatgctctttggagaagacaacctgaagctgttcaccttcttgat
aagattttgaagaaacacaaacctgacttcatctcattgttcaaaaatccgccaaaaaat
gttcaacagcatgagaaggttcagaaagccagtacagagggagttgccattcagggtcaa
cagggaactcgacttcttcctgaacagctcgttaaagaagcctttattctcagtgacctt
tttgatattggagaattggcagctgttgagcttcttcttgctggagagcatcaacagcca
cattttcctggccttaccagaggattagtagctgttcttttgtactgggatggaaagcga
tgcattgcaaattccttgaaagccttgatacagtctagacggggaaagacatggacccta
gaactcagtccagagctggcatccatgacaacacgctttacagatgagctgatggagcaa
ggattgacttataaagttcttaccctggtgtcacaaattgatgtgaataatgagtttgag
aaactacagcgagagagaggtttgggcagtgaaaaacatcgcaaagaggtttctgatctc
attaaggagtgcaggcagtctcttgcagaaagcctttttgcctgggcttgccagtcacct
ttaggcaaagaagacactctcctcctcattggacatttggaaagagtgacagttgaggct
aatggctcactggatgcagtgaatttggctcttcttatggcgcttctatactgttttgat
atcagttttatagagcaaagcacagaggaacgagatgatatgattcatcaacttccactg
ttgacagaaaaacagtacattgcaacaattcactctcgtcttcaggactcacagctttgg
aaactgcctgggctccaagccactgttagacttgcctgggcgctggcattgaggggaata
tcccagctacctgatgtgacaggtgaattgattgtagctctggcagaattcacagaggca
gatgaagcaatggcagagctcgcaattgctgacaacgttttcctgttcctcacggaatct
gtagtggtatcagaatacttttatcaggaagaattttatattcgcagagtccataatctc
atcacagatttccttgcacttatgccaatgaaggtgaaacagctgaggaatcgggcagat
gaagatgctcgaatgattcacatgagtatgcagatgggtaatgaaccccccatttcactt
agaagggacctggaacacttaatgcttttgattggcgagctatataaaaagaaccctttt
catctggagcttgctctagaatattggtgtcccacagagcctcttcagactccgactatc
atgggttcttatctaggggtggctcatcagcggccccctcaacgccaggttgtcttgtca
aagtttgttaggcaaatgggtgacctgttgcctccaactatttatattccttatttgaag
atgctccagggattggccaatgggcctcagtgtgcccactactgtttcagcctgctcaaa
gtcaatggtagtagtcatgttgaaaatattcagggcgcaggtggcagtcctgtttcctgg
gaacatttctttcactctttgatgctttaccatgaacaccttcggaaggatcttccaagt
gcagatagcgtccagtaccggcaccttccttcccgtggcatcacccagaaggagcaagat
ggattgattgcttttttgcagctcacgtctaccatcgttacttggagtgaaaatgctcgc
ttggcactctgtgaacaccctcagtggacccctgttgtagtgattctgggactcctccaa
tgtagtattccccctgtcctaaaagctgagctactgaagacacttgcagcttttggaaaa
tctcctgaaattgctgcttccctctggcagtcattggaatacactcagatactgcagact
gtgaggattccaagccaaaggcaagctattggtatcgaggttgaactaaatgaaatagaa
tcccggtgtgaagaatacccattgactcgggccttttgccagcttattagtaccctggtg
gagagctcatttccttctaatttgggtgctggactgcggccccctggctttgacccttat
ttgcagttccttagagactctgtgtttctacgattccgtacgagagcttaccggagagca
gctgaaaagtgggaagttgctgaggtggttttggaggtgttttataaattgctcagagat
tatgagcctcagcttgaagattttgtagaccagtttgtggaactacaaggagaagaaatc
atagcctataagccacctggatttagtctgatgtatcatctgctgaatgagtcaccaatg
ttggagcttgctctcagtttactggaagaaggagttaagcagcttgacacctatgccccc
tttcctgggaaaaaacacctggagaaagcagtacagcattgccttgcacttctcaatctt
actctgcaaaaggaaaatctttttatggaccttctaagagagagtcaactggctctaata
gtctgtcctttagaacagcttttgcagggaattaatcccagaactaagaaggcagataat
gtggtaaacattgccagatacctatatcatggcaatactaatccagaattggcttttgaa
agtgccaagatcctctgttgtatctcttgcaactctaatattcagataaagttggttgga
gatttcacacatgaccagagtataagtcagaaactaatggctggatttgtggagtgtttg
gattgtgaagatgcagaagaatttgtacgtctggaagagggatcagaacttgaaaagaaa
ttagttgcaattcgtcatgaaacaagaatccacatcttgaatcttctcattacctctctg
gaatgcaatccacccaatcttgctctctacttgttgggctttgaattgaagaaacctgtc
agtactacaaacctacaagatccaggagtgttaggttgccctcggacatgccttcacgcc
attctaaacatcttggagaaaggaacggaagggagaacaggcccagtggcagtgcgagaa
tctcctcaactggctgagctatgttaccaggtcatatatcagttatgtgcatgctctgat
acatctggtcctactatgaggtacttgagaaccagccaggatttcttattttcccagttg
cagtatctaccattttctaacaaagaatatgaaatatctatgctgaaccagatgtcatgg
cttatgaaaactgcctcaatagagctaagggtaacctctctgaatcgtcagcggtcgcat
acccagaggctcctacacctcttattggatgacatgccagtgaaaccatactcagatggt
gaaggaggaatagaagatgaaaacaggtctgtttctgggttccttcactttgacactgct
acaaaagtacgtcgaaaaattctaaatattcttgactcgattgacttcagtcaggagatc
cctgagcctttgcagttggatttttttgatcgggcccagattgaacaagttattgctaac
tgtgaacacaagaatttacggggacagacagtctgcaatgtcaagcttcttcatagggtt
cttgtagctgaagtaaatgcccttcagggtatggcagccataggacagagacctctactc
atggaggaaataagcactgtacttcagtatgtggtaggaagaaataaattgctgcagtgt
cttcatgcaaaacgtcatgctctggaatcgtggaggcaactggtagaaattatactgaca
gcttgtccccaggacctcattcaggcagaggatcgacaactgattattcgtgatatttta
caagatgtgcatgataagatactggatgatgaagcagcgcaagagttaatgcctgtggtc
gccggggcagtgttcacactaactgctcacctaagccaggccgtcctcaccgaacagaag
caaacatcagtcttgggaccagcagaggcccattacgcttttatgcttgatagttgcttc
acctcacctcctccagaagagaacccattagtgggttttgcttctattggagattcttca
ctttacatcatattgaagaaactgttagacttcattttgaagacaggtggtggattccaa
cgagtgaggactcacttgtatggctctctgctttattacttacagattgcccagagacct
gatgaaccagataccttagaagcagccaagaaaaccatgtgggaaaggctgacagcccct
gaagatgtatttagcaaattacagcgagaaaacatagccattattgaaagttatggcgcc
gccctcatggaagtggtctgtcgagatgcttgtgatggtcatgagattggaaggatgctg
gccctggctctacttgatagaattgtctctgtggataaacagcagcagtggcttttgtat
ctttctaacagtggctacttgaaggtcctcgtagacagcttggtagaagatgaccgtact
ttgcagagcttactcacaccacagcctccccttttaaaagcactttatacttatgaatct
aaaatggcatttctaacaagagtggcaaagatacagcagggtgcattagagctgctaaga
tcaggggtgattgtgagactagctcaatgccaagtctatgacatgcgcccagaaacggac
ccacagagcatgtttggcatgagagaccctccaatgttcatccctaccccagtggatcgc
taccgccagattctcctcccagctctccagctgtgccaggtcatcctcacatctagtatg
gcccagcacttgcaggcagcaggacaggtattgcagtttcttatttcacattctgatacc
atacaagcaattctgcgctgtcaggatgttagtgctgggtctttgcaggaattggctctg
ctgacaggaattataagtaaagcagcacttcctgggatattaagtgaacttgacgttgat
gtaaatgaagggtctctaatggagctacagggacatattggaagattccagcgccagtgc
ttaggactactaagtcgctttggtggctctgacagactgcgtcagtttaaatttcaagac
gataatgtggagggagataaagtaagcaagaaagatgagattgaactggctatgcagcag
atttgtgccaatgtaatggaatattgccaatcgctcatgttacagagttcccctaccttc
cagcatgctgtgtgtctcttcactcctagcctttcagaaacagttaatagagatggaccg
cggcaagatacccaagctccagtggttccatactggcgcctgcctggtttaggcattatc
atctacctgctgaaacagagtgctaatgatttcttcagctattatgacagtcatcgacag
agtgtcagcaagctacaaaatgtagagcagcttcccccagatgagataaaagagttgtgt
cagtctgtgatgcctgctggtgttgataaaatctccactgcccagaaatatgttctagca
agacggcgcttggtgaaggtgatcaacaatcgagctaaactgctttccctttgttctttt
atcatagagacctgcctatttattctttggcgccatctggagtactacttgttacattgc
atgcccacggattctcaagattccttatttgcttcaagaaccttgtttaaaagcagaaga
ctgcaagattccttcgcctcagacacccatctagattttagaagtgcgctggctatagtg
agccaacatgatttagaccagcttcaggctgatgcaatcaacgcttttggagaatcacta
caaaagaaacttctggacattgaaggattatattcaaaagttcgatctcgatatagtttc
atacaggctcttgtcagacgtatccgtggcctcttgaggatatcaaggaactga

DBGET integrated database retrieval system