KEGG   Pongo abelii (Sumatran orangutan): 100447986
Entry
100447986         CDS       T01416                                 

Gene name
GTF2F2
Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100447986 (GTF2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100447986 (GTF2F2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100447986 (GTF2F2)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     100447986 (GTF2F2)
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N SRP54
Other DBs
NCBI-GeneID: 100447986
NCBI-ProteinID: XP_002824282
Ensembl: ENSPPYG00000005333
UniProt: A0A663DEV8 H2NJT1
Position
13
AA seq 249 aa
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
NT seq 750 nt   +upstreamnt  +downstreamnt
atggctgagcgcggggaactcgacttgaccggcgccaaacagaacacaggagtgtggcta
gtcaaggttcctaaatatttgtcacagcaatgggctaaagcctctggaagaggtgaagtt
gggaaactgcggattgccaagactcaaggaaggactgaggtgtcatttactttgaatgag
gatcttgcaaatattcatgatattggtggaaaaccggcttcagtcagtgctcctagagaa
catccatttgtcttgcaaagtgttggaggacagacattaacagtatttactgagagctca
tcagataagctgtcattggaaggaatagtggtacaaagagctgagtgccgaccagctgcc
agtgaaaactacatgcgattaaaaagattgcaaatagaagagtcttccaaacctgtgagg
ctatcacaacagctggacaaagttgtaacaaccaattacaaacctgttgctaatcatcaa
tacaatattgaatatgaaaggaaaaagaaagaagacggaaagcgagctcgagctgataaa
caacatgttttagacatgctattttcagcctttgagaaacatcaatactataatcttaag
gacttggtggacatcacaaaacaacctgtggtgtacctgaaggaaatcttaaaagaaatt
ggtgttcagaatgtaaaagggatccacaaaaacacatgggagctgaagccagagtacaga
cactatcaaggagaagaaaagagtgactaa

DBGET integrated database retrieval system