KEGG   Pongo abelii (Sumatran orangutan): 100448282Help
Entry
100448282         CDS       T01416                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E isoform X1
  KO
K03259  translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon03013  RNA transport
pon04066  HIF-1 signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04211  Longevity regulating pathway
pon04910  Insulin signaling pathway
Module
pon_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100448282 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100448282 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100448282 (EIF4E)
   04150 mTOR signaling pathway
    100448282 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100448282 (EIF4E)
  Aging
   04211 Longevity regulating pathway - mammal
    100448282 (EIF4E)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100448282 (EIF4E)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100448282 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100448282 (EIF4E)
Translation factors [BR:pon03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100448282 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100448282
NCBI-ProteinID: XP_024101817
Position
4
AA seq 240 aa AA seqDB search
MAELEFQHGEHGSRGCDQKQCISYSDDNLETTPTPNPPTTEEEKTESNQEVANPEHYIKH
PLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDG
IEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVR
AKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctggaattccaacatggggaacatggctctagagggtgtgatcagaagcag
tgcatctcatattctgatgacaatctggaaaccacccctactcctaatcccccgactaca
gaagaggagaaaacggaatctaatcaggaggttgctaacccagaacactatattaaacat
cccctacagaacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaa
gcaaacctgcggctgatctccaagtttgatactgttgaagacttttgggctctgtacaac
catatccagttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggt
attgagcctatgtgggaagatgagaaaaacaaacggggaggacgatggctaattacattg
aacaaacagcagagacgaagtgacctcgatcgcttttggctagagacacttctgtgcctt
attggagaatcttttgatgactacagtgatgatgtatgtggcgctgttgttaatgttaga
gctaaaggtgataagatagcaatatggactactgaatgtgaaaacagagaagctgttaca
catatagggagggtatacaaggaaaggttaggacttcctccaaagatagtgattggttat
cagtcccacgcagacacagctactaagagcggctccaccactaaaaataggtttgttgtt
taa

DBGET integrated database retrieval system