KEGG   Pongo abelii (Sumatran orangutan): 100448415Help
Entry
100448415         CDS       T01416                                 

Gene name
GGT1
Definition
(RefSeq) glutathione hydrolase 1 proenzyme
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00430  Taurine and hypotaurine metabolism
pon00480  Glutathione metabolism
pon00590  Arachidonic acid metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100448415 (GGT1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    100448415 (GGT1)
   00480 Glutathione metabolism
    100448415 (GGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100448415 (GGT1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100448415 (GGT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     100448415 (GGT1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     100448415 (GGT1)
    3.4.19.14  leukotriene-C4 hydrolase
     100448415 (GGT1)
Peptidases and inhibitors [BR:pon01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   100448415 (GGT1)
CD molecules [BR:pon04090]
 Proteins
  100448415 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept NAD_synthase
Motif
Other DBs
NCBI-GeneID: 100448415
NCBI-ProteinID: XP_002830985
Ensembl: ENSPPYG00000011650
UniProt: H2P3V1
Position
22
AA seq 569 aa AA seqDB search
MKKKVVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYARAAVAADAKQCSEIGRDALQD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSATRKAEVINAREVAPRLAFASMFN
SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALEN
KRTVIEQQPVLCEVFCQDGKVLREGERLTLPRLADTYETLAIEGAQAFYNGSLTAQIVKD
IQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSR
ESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD
DTTHPISYYKPEFYTPDDGGTAHLSVIAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGASGGTQITTA
TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTF
IAVVQAIVRTAGGWAAASDSRKGGEPAGY
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaggtagtggtgctgggcctgctggccgtggtcctggtgctggtcattgtt
ggcctctgtctctggctgccctcggcctccaaggaacctgacaaccatgtgtacgccagg
gctgccgtggctgcggatgccaagcagtgttcggagattgggagggacgcactgcaggac
ggtggctctgcggtggatgcagccattgcagccctgttgtgtgtggggctcatgaatgcc
cacagcatgggcatcgggggtggcctcttcctcaccatctacaacagcgccacacgtaaa
gctgaggtcatcaacgcccgcgaggtggcccccaggctggcctttgccagcatgttcaac
agctcggagcagtcccagaagggggggctgtcagtggcagtgcctggggagatccgaggc
tatgagctggcacaccagcggcatgggcggctgccctgggctcgcctcttccagcctagc
atccagctggcccgccagggcttccccgtgggcaagggcttggcggcagccctggaaaac
aagcggaccgtcattgagcagcaacctgtcttgtgtgaggtgttctgccaggacggaaag
gtgcttcgggagggggagagactgaccctgccacggctggctgacacctacgagacgctg
gccatcgagggtgcccaggccttctacaacggcagcctcacggcccagattgtgaaggac
atccaggcagccgggggcattgtgacagctgaggatctgaacaactaccgtgctgagctg
atcgagcacccgctgaacatcagcctgggagacgcggtgctgtacatgcccagtgctccg
ctcagtgggcccgtgctggccctcatcctcaacatcctcaaagggtacaacttctcccgg
gagagtgtggagacccctgagcagaagggcctgacataccaccgcattgtagaggctttc
cggtttgcctacgccaagaggaccctgcttggggaccccaagtttgtggatgtgactgag
gtggtccgcaacatgacctccgagttcttcgctgcccagctccgggcccagatctctgac
gacaccactcacccgatctcctactacaagcccgagttctacacgccagatgatgggggc
actgctcacctgtctgtcatcgcagaggacggcagtgctgtgtctgccaccagcaccatc
aacctctactttggctctaaggtccgctccccggtcagcgggatcctgttcaataatgaa
atggatgacttcagctctcccagcatcaccaacgagtttggggtacccccctcacctgcc
aatttcatccagccagggaagcagccgctctcgtccatgtgcccaacgatcatggtgggc
caggacggccaggtccggatggtggtgggagcttctgggggcacgcagatcaccacggcc
actgcactggccatcatctacaacctctggttcggctatgacgtgaagcgggccgtggag
gagccccggctgcacaaccagcttctgcccaacgtcacgacagtggagagaaacattgac
caggcagtaactgcagccctggagacccggcaccatcacacccagatcgcgtccaccttc
atcgctgtggtgcaagccatcgtccgcacggctggtggctgggcagctgcctcggactcc
aggaaaggcggggaacctgctggctactga

DBGET integrated database retrieval system