KEGG   Pongo abelii (Sumatran orangutan): 100449143Help
Entry
100449143         CDS       T01416                                 

Gene name
G6PD
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X2
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00030  Pentose phosphate pathway
pon00480  Glutathione metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon05230  Central carbon metabolism in cancer
Module
pon_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pon_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100449143 (G6PD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100449143 (G6PD)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100449143 (G6PD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100449143 (G6PD)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     100449143 (G6PD)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     100449143 (G6PD)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100449143 (G6PD)
  Exosomal proteins of colorectal cancer cells
   100449143 (G6PD)
  Exosomal proteins of bladder cancer cells
   100449143 (G6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 100449143
NCBI-ProteinID: XP_002832357
Ensembl: ENSPPYG00000020885
Position
X
AA seq 545 aa AA seqDB search
MGWRGSVPGNGRTLRGCERGGRRRRNADSVMAEQVALSRTQVCGILREELFQGDAFHQSD
THIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKA
NPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAV
TKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQN
LMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCL
VAMEKPASTNSDDVRDEKVKVLKCISEVQASNVVLGQYVGNPDGEGEATKGYLDDPTVPR
GSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNEL
VIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQM
HFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWV
NPHKL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgggctggcggggctcagtccccggaaacggccgtacacttcggggctgcgagcgcgga
gggcggcgacgacgaaacgcagacagcgtcatggcagagcaggtggccctgagccggacc
caggtgtgtgggatcctgcgggaagagctgttccagggcgatgccttccatcagtcggat
acacacatattcatcatcatgggtgcatcgggtgacctggccaagaagaagatctacccc
accatctggtggctgttccgggatggccttctgcccgaaaacaccttcatcgtgggctat
gcccgctcccgcctcacagtggctgacatccgcaaacagagtgagcccttcttcaaggcc
aacccagaggagaagctcaagctggaggacttctttgcccgcaactcctatgtggctggc
cagtacgatgatgcagcctcctaccagcgcctcaacagccacatgaatgccctccacctg
gggtcacaggccaaccgcctcttctacctggccttgccccccaccgtctacgaggccgtc
accaagaacattcacgagtcctgcatgagccagataggctggaaccgcatcatcgtggag
aagcccttcgggagggacctgcagagctccgaccggctgtccaaccacatctcctccctg
ttccgcgaggaccagatctaccgcatcgaccactacctgggcaaggagatggtgcagaac
ctcatggtgctgagatttgccaacaggatcttcggccccatctggaaccgggacaacatc
gcctgcgtgatcctcaccttcaaggagccctttggcactgagggtcgcgggggctatttc
gatgaatttgggatcatccgggacgtgatgcagaaccacctactgcagatgctgtgtctg
gtggccatggagaagcccgcctccaccaactcggatgacgtccgtgatgagaaggtcaag
gtgttgaaatgtatctcagaggtgcaggccagcaatgtggtcctgggccagtacgtgggg
aaccccgatggagagggcgaggccaccaaagggtacctggacgaccccacggtgccccgc
gggtccaccaccgccacttttgcagccgtcgtcctctatgtggagaatgagaggtgggat
ggggtgcccttcatcctgcgctgtggcaaggccctgaacgagcgcaaggccgaagtgagg
ctacagttccatgatgtggccggcgacatcttccaccagcagtgcaagcgcaacgagctg
gtgatccgcgtgcagcccaacgaggccgtgtacaccaagatgatgaccaagaagccgggc
atgttcttcaaccccgaggagtcggagctggacctgacctacggcaacagatacaagaac
gtgaagctccctgacgcctacgagcgcctcatcctggacgtcttctgcgggagccagatg
cacttcgtgcgcagcgacgagctccgtgaggcctggcgtattttcaccccactgctgcac
cagattgagctggagaagcccaagcccatcccctatatttatggcagccgaggccccacg
gaggcagacgagctgatgaagagagtgggtttccagtatgagggcacctacaagtgggtg
aacccccacaagctctga

DBGET integrated database retrieval system