KEGG   Pongo abelii (Sumatran orangutan): 100449666Help
Entry
100449666         CDS       T01416                                 

Gene name
SMUG1
Definition
(RefSeq) single-strand selective monofunctional uracil DNA glycosylase isoform X1
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100449666 (SMUG1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100449666 (SMUG1)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     100449666 (SMUG1)
 Prokaryotic Type
     100449666 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG DUF4918
Motif
Other DBs
NCBI-GeneID: 100449666
NCBI-ProteinID: XP_002823385
Ensembl: ENSPPYG00000004598
UniProt: A0A2J8UIL4
Position
12
AA seq 270 aa AA seqDB search
MPQAFLLGSIHEPAVALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLGICDAALRRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggctttcctgctggggtccatccatgagcctgcggttgccctgatggagccc
cagccctgccctggaagcttggctgagagcttcctggaggaggagcttcggctcaatgct
gagctgagccagctgcagttttcggagcctgtgggcatcatctataatcccgtggagtat
gcatgggagccacatcgcaactacgtgactcgctactgccagggccccaaggaagtgctc
ttcctgggcatgaaccctggaccttttggcatggcccagactggggtgccctttggggaa
gtaagcatggtccgggactggttgggcattgtggggcctgtgctgacccctccccaagag
catcctaaacgaccagtgctgggactggagtgcccacagtcagaagtgagtggtgcccga
ttctggggctttttccggaacctctgtggacagcctgaggtcttcttccatcactgtttt
gtccacaatctatgccctctgcttttcctggctcccagcgggcgcaacctcacccctgct
gagctgcctgccaagcagcgagaacagcttcttgggatctgtgatgcagccctccgccgg
caggtgcagctgctgggggtgcggctggtggtgggagttgggcgactggcagagcagcgg
gcacgacgggctctggcaggcctgatgccagaggtccaggtggaagggctcctgcatccc
tctccccgtaacccacaggccaacaaaggctgggaggcagtggccaaggaaagattgaat
gagctggggctgctgccactgctgttgaaatga

DBGET integrated database retrieval system