KEGG   Pongo abelii (Sumatran orangutan): 100449853Help
Entry
100449853         CDS       T01416                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05014  Amyotrophic lateral sclerosis (ALS)
pon05132  Salmonella infection
pon05133  Pertussis
pon05140  Leishmaniasis
pon05142  Chagas disease (American trypanosomiasis)
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05205  Proteoglycans in cancer
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100449853 (MAPK13)
   04010 MAPK signaling pathway
    100449853 (MAPK13)
   04370 VEGF signaling pathway
    100449853 (MAPK13)
   04668 TNF signaling pathway
    100449853 (MAPK13)
   04068 FoxO signaling pathway
    100449853 (MAPK13)
   04071 Sphingolipid signaling pathway
    100449853 (MAPK13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100449853 (MAPK13)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100449853 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100449853 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100449853 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100449853 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100449853 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100449853 (MAPK13)
   04660 T cell receptor signaling pathway
    100449853 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100449853 (MAPK13)
   04659 Th17 cell differentiation
    100449853 (MAPK13)
   04657 IL-17 signaling pathway
    100449853 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100449853 (MAPK13)
   04670 Leukocyte transendothelial migration
    100449853 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    100449853 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100449853 (MAPK13)
   04917 Prolactin signaling pathway
    100449853 (MAPK13)
   04926 Relaxin signaling pathway
    100449853 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100449853 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    100449853 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100449853 (MAPK13)
   04722 Neurotrophin signaling pathway
    100449853 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100449853 (MAPK13)
  Development
   04380 Osteoclast differentiation
    100449853 (MAPK13)
  Environmental adaptation
   04714 Thermogenesis
    100449853 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100449853 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100449853 (MAPK13)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100449853 (MAPK13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449853 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    100449853 (MAPK13)
   05133 Pertussis
    100449853 (MAPK13)
   05152 Tuberculosis
    100449853 (MAPK13)
   05164 Influenza A
    100449853 (MAPK13)
   05160 Hepatitis C
    100449853 (MAPK13)
   05163 Human cytomegalovirus infection
    100449853 (MAPK13)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100449853 (MAPK13)
   05169 Epstein-Barr virus infection
    100449853 (MAPK13)
   05145 Toxoplasmosis
    100449853 (MAPK13)
   05140 Leishmaniasis
    100449853 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    100449853 (MAPK13)
  Drug resistance
   01522 Endocrine resistance
    100449853 (MAPK13)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100449853 (MAPK13)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100449853 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase DUF4023
Motif
Other DBs
NCBI-GeneID: 100449853
NCBI-ProteinID: XP_002816849
Ensembl: ENSPPYG00000016540
UniProt: H2PIU8
Position
6
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPLDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagttgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaaaatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactcggctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagatgccgaaatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacggtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcgtacatccag
tccctgccacagacccccaggaaggatttcactcagctcttcccacgggccagcccccag
gccgcagacctgctggagaagatgctggagctagacgtggacaagcgcttgacggccgca
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgttagatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system