KEGG   Pongo abelii (Sumatran orangutan): 100451208
Entry
100451208         CDS       T01416                                 

Gene name
ETV7
Definition
(RefSeq) transcription factor ETV7 isoform X1
  KO
K03211  ETS translocation variant 6/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100451208 (ETV7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100451208 (ETV7)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100451208 (ETV7)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 100451208
NCBI-ProteinID: XP_002816853
Ensembl: ENSPPYG00000016544
UniProt: H2PIV3
Position
6
AA seq 341 aa
MQEGELAISPISPVAAMPPLGTDVQARCEAQINLLGEGGICKLPGRLRIQPTLWSREDVL
HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
VCGPFFGGAFRLKMPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA
RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE
PYIKWEDKDAKIFRVVDPDGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
LFRFLKTPGKMVQDKDSHLEPLDSQEQDRMEFKDKRPEISP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcaggagggagaattggctatttctcctataagccctgtggcagccatgcctccctta
ggcaccgacgtgcaagccagatgtgaagctcaaattaacctgctgggtgaaggggggatc
tgcaagctgccaggaagactccgcatccagcccacactatggagcagggaggacgtgctg
cactggctacgctgggcagagcaggagtactctctgccatgcaccgcagagcacgggttc
gagatgaacggacgcgccctctgcatcctcaccaaggacgacttccggcaccgtgcgccc
agctcaggtgatgtcctgtatgagctgctccagtacatcaagacccagcggcgagccctg
gtgtgtgggcccttttttggaggggccttcaggctgaagatgcccacccagcactctcct
gtccccccagaagaggtgactggcccctctcagatggacacccgaaggggccacctgctg
cagccaccagacccagggcttaccagcaacttcggccacctggatgaccctggcctggca
aggtggacccctggcaaggaggagtccctcaacttatgtcactgtgcagagctcggctgc
aggacccagggggtctgttccttccccgcgatgccgcaggcccccattgacggcaggatc
gctgactgccggctgctgtgggattacgtgtatcagctgctccttgacaccaggtatgag
ccctacattaagtgggaagacaaggatgccaagatcttccgagttgtggatccagatggg
ctcgccagactctggggaaatcacaagaaccgggtgaacatgacctacgagaagatgtct
cgtgccctgcgccactattataagcttaatatcattaagaaggaaccggggcagaaactc
ttgttcagatttctaaagactccgggaaagatggtccaggacaaggacagccacctggag
ccgctggacagccaggagcaggacagaatggagttcaaggacaagaggccagaaatctct
ccgtga

DBGET integrated database retrieval system