KEGG   Pongo abelii (Sumatran orangutan): 100451211Help
Entry
100451211         CDS       T01416                                 

Gene name
GUCY2F
Definition
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100451211 (GUCY2F)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100451211 (GUCY2F)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100451211 (GUCY2F)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100451211 (GUCY2F)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100451211 (GUCY2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Guanylate_cyc Pkinase_Tyr Pkinase HNOBA Kinase-like TetR_C_11
Motif
Other DBs
NCBI-GeneID: 100451211
NCBI-ProteinID: XP_002832066
Ensembl: ENSPPYG00000020624
Position
X
AA seq 1108 aa AA seqDB search
MFLGLGRFSRLVLWFAAFRKLLGHHGLASSKFLWCLCLLSVMSLPQQVWTLPYKIGVVGP
WACDSLFSKALPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPTNPGYCEAASFLGNSWDKGIFSWACVNYELDNKNSYPTFSRTLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQAD
RIRIIIMCMHSALIGGETQMHLLEWAHDLKMTDGTYVFVPYDALLYSLPYKHTPYQVLRN
NPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIA
QAMNNAMKENGQAGAASLVQHSRNMQFYGFNQLIRTDSNGNGISEYVILDTNWKEWELHS
TYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAERKICHGGIDPAFAMMVCLTLLIAL
LSINGFAYCIRRRINKIQLIKGPSRILLTLEDVTFINPHFGSKRGSRASVSFQITSEVQS
GRSPRLSFSSGSLTPATYENSNIAIYEGDWVWLKKFSPGDFGDVKSIKSRASDVFEMMKD
LRHENINPLLGFFYDLGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSVEELLWTAPELLRA
PRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKAPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLVGKKGFMKPLPVPPPVDKDG
QVGHGLQPVEIAAFQRRKAERQLVRNKP
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggactcgggcgtttttctcgccttgtgctctggtttgcggctttcaggaaa
ctgctgggacaccatggccttgcatcctccaagttcctgtggtgcttgtgccttctgtct
gtcatgtcccttccgcagcaggtgtggacactcccctacaagataggggtggtgggccct
tgggcttgtgattcgctgttttcgaaggccctgcctgaggttgctgctcgattagccatt
gagcgaatcaaccgggacccatcttttgacctgagttattcttttgaatatgtgattctc
aatgaagactgccagacttcgagggccctctccagtttcatttcccaccaccagatggcc
tcaggatttattggccctaccaaccctggctactgcgaggcagcctcgttcctgggaaac
agctgggacaaagggattttctcttgggcttgtgtgaattatgaattagacaataaaaat
agctacccgaccttttctcggacactcccttctcccatccgggtgcttgtaactgtcatg
aaatatttccagtgggctcatgctggagtcatttcctcagatgaagacatttgggtgcat
acagccaatcgagtcgcaagtgctcttcggagccacggcttacctgtaggggtcgtcctg
accacaggacaagacagccaaagcatgcggaaagctctccagaggattcaccaggcagac
agaattcgcataatcatcatgtgtatgcattcagctttgattgggggagagactcagatg
catctcttggaatgggctcatgatctgaaaatgactgatggaacctacgtctttgttcct
tatgatgccctgctctacagtttaccttataagcacaccccttaccaggtcctaaggaac
aacccaaagctccgggaagcctatgatgcagtgttgaccattacagtggagtcccaagaa
aagaccttctatcaagcctttacagaggcagcagcaagaggtgaaattcctgagaagctg
gagttcgatcaagtttcaccgttgtttggaaccatctacaattcaatttactttatcgca
caagccatgaataatgctatgaaagaaaatggacaggctggtgctgccagcctggttcag
cattccagaaacatgcagttctatggattcaaccagttgataaggacagattcaaatgga
aatggaatttcagaatatgtaatcctggacaccaactggaaagaatgggaactccatagc
acctacactgtggacatggaaatggagctgctacgttttggagggacccctattcacttc
cctggtggcaggccccctagagcagatgcaaaatgctggtttgcagaacggaagatctgc
catggaggcatcgaccctgcctttgccatgatggtctgccttactttgcttatagccctg
ctgtctattaatggatttgcttactgtataaggcgtcgtataaataaaatccagttgatc
aaaggacccagtagaattctactgactttggaggatgtaacatttatcaatccccacttt
ggcagtaagagaggaagtcgtgccagtgtaagcttccagattacctcagaggtccaaagt
gggaggtccccaagactctccttttcttcagggagtctaactccagctacctatgaaaac
tccaacatagcgatttatgagggtgattgggtgtggctgaaaaagttctcccctggagat
tttggagacgttaagtccatcaaatcaagagcaagtgatgtgttcgaaatgatgaaggac
ttgcgtcatgagaatattaaccctttattgggtttcttctatgatttggggatgtttgcc
attgtaacagaattctgttcccgagggagcctagaagacatactgacaaatcaagatgtg
aaactcgactggatgtttaaatcatcactcctgctggatctcataaagggcatgaagtac
ttacaccacagagagtttgttcatgggaggctaaagtctcgaaactgtgtggtagatggg
cgttttgtactaaaagtgacagattatggctttaacgacatcttagaaatgttgagactc
tctgaagaggaatcttctgtggaagagctgctgtggactgcccctgaactgttgagagct
ccaagaggcagcaggttaggttcttttgcaggagacgtctatagctttgccatcatcatg
caagaagtgatggtccggggtaccccattctgcatgatggatctgccagctcaagaaatc
ataaacagacttaagaaggctcctcctgtctacagaccagtagttcctcctgagcatgcc
cctccagaatgtctccagctgatgaagcagtgctgggctgaggctgcagaacaacgacca
acttttgatgaaatatttaaccagtttaaaacttttaataaagggaagaagaccaacatt
attgattctatgcttcggatgttggagcaatattctagcaacttggaagatttgattcgg
gagcggactgaagagctggaaattgaaaaacagaaaacggaaaagcttctaacacagatg
ctaccaccatcagttgctgaatctctcaaaaagggctgcacagttgaacctgagggcttt
gacttggtcaccttgtacttcagcgacattgtgggcttcacaaccatttcagccatgagt
gagcccattgaggtggtggatcttctgaatgacctgtacacactctttgatgcaataatt
ggcagtcatgatgtctacaaggtagagaccattggagatgcctacatggtggcttcaggc
ctcccaaagaggaatggcagtaggcatgcagctgagattgcaaacatgtccttagatatc
ctgagctctgtgggcactttcaagatgcggcacatgccagaggtgccagtccgaattcga
attggcctgcactcagggccggttgttgctggagtggtgggcctcaccatgcccagatac
tgcttgtttggagacactgtgaacacagcttctcggatggaatcaacaggcttaccttat
cgcattcatgtcagtctcagcactgttacaattcttcaaaatctgagtgagggctatgaa
gtggagcttcgaggaagaacagagctcaagggcaaaggcactgaggagaccttctggctg
gttgggaaaaaaggcttcatgaagccccttcctgtgcccccaccagtggacaaagatggg
caagtgggccatggcctgcaaccagtggagattgcagccttccaaagaagaaaagcagaa
aggcagttggtgagaaacaagccataa

DBGET integrated database retrieval system