KEGG   Pongo abelii (Sumatran orangutan): 100451422Help
Entry
100451422         CDS       T01416                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04520  Adherens junction
pon04910  Insulin signaling pathway
pon04913  Ovarian steroidogenesis
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon04960  Aldosterone-regulated sodium reabsorption
Module
pon_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100451422 (INSR)
   04015 Rap1 signaling pathway
    100451422 (INSR)
   04010 MAPK signaling pathway
    100451422 (INSR)
   04066 HIF-1 signaling pathway
    100451422 (INSR)
   04068 FoxO signaling pathway
    100451422 (INSR)
   04072 Phospholipase D signaling pathway
    100451422 (INSR)
   04022 cGMP - PKG signaling pathway
    100451422 (INSR)
   04151 PI3K-Akt signaling pathway
    100451422 (INSR)
   04152 AMPK signaling pathway
    100451422 (INSR)
   04150 mTOR signaling pathway
    100451422 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100451422 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100451422 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100451422 (INSR)
   04913 Ovarian Steroidogenesis
    100451422 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100451422 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100451422 (INSR)
   04213 Longevity regulating pathway - multiple species
    100451422 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100451422 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100451422 (INSR)
   04931 Insulin resistance
    100451422 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100451422 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:pon04090]
    100451422 (INSR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100451422 (INSR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100451422 (INSR)
CD molecules [BR:pon04090]
 Proteins
  100451422 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100451422
NCBI-ProteinID: XP_024092866
Position
19
AA seq 1370 aa AA seqDB search
MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNVTAAVPTVAAFPNTSSTSVPTSP
EEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADD
IVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
LRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI
GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQG
SFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV
VSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNA
KKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGV
FTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMC
WQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRS
SHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctattgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttaatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcataatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtattgaacaaagatgacaatgag
gagtgtggagacatctgtccgggtaccgcaaagggcaagaccaactgccccgccactgtc
atcaatgggcagtttgtcgaacgctgttggactcatagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacatctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggat
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgacgggcaggatgcgtgtggttccaacagctggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccaggatggctgatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattttg
aagtggaaacccccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
tttgtccccaggccatctcggaaacgcaggtcccttggcgatgttgggaatgtgacagcg
gctgtgcccacggtggcagctttccccaacacttcctcaaccagcgtgcccacgagtccg
gaggagcacaggccctttgagaaggtggtaaacaaggagtcgctggtcatctctggcttg
cgacacttcacaggctatcgcatcgagctgcaggcttgcaaccaagacacccctgaggaa
cggtgcagtgtggcagcctacgtcagtgccaggaccatgcctgaagccaaggctgatgac
atcgtcggccctgtgacgcacgaaatctttgagaacaacgttgtccacttgatgtggcag
gagccgaaggagcccaatggtctgatcgtgctgtatgaagtgagttatcggcgatatggc
gatgaggagctgcatctctgcgtctcccgcaagcacttcgctctggaacggggctgcagg
ctgcgtgggctgtcgccggggaactacagcgtgcgagtccgggccacctcccttgcgggc
aacggctcctggacggaacccacctatttctacgtgacagactatttagatgtcccgtca
aatattgcaaaaattatcatcggccccctcatctttgtctttctcttcagtgttgtgatt
ggaagtatttatctattcctgagaaagaggcagccagatgggccgctgggaccgctttac
gcttcttcaaaccctgagtatctcagtgccagtgatgtgtttccatgctctgtgtacgtg
ccggacgagtgggaggtgcctcgagagaagataaccctccttcgagagctggggcagggc
tccttcggcatggtatatgagggcaacgccagggacatcatcaagggtgaggcagagacc
cgtgtggcggtgaagacggtcaacgagtcagccagtctccgagagcggattgaattcctc
aatgaggcctcggtcatgaagggcttcacctgccatcacgtggtgcgcctcctgggagtg
gtgtccaagggccagcccacgctggtggtgatggagctgatggctcatggagacctgaag
agctacctccgttctctgcggccagaggctgagaataatcctggccgccctccgcctacc
ctgcaagagatgattcagatggcggcagagattgctgacgggatggcctacctgaacgcc
aagaagtttgtgcatcgggacctggcagcgagaaactgcatggtcgcccatgattttact
gtcaaaattggagactttggaatgaccagagacatctatgaaacggattactaccggaaa
gggggtaagggtctgctccctgtacggtggatggcgccggagtccctgaaggatggggtc
tttaccacttcttctgacatgtggtcctttggcgtggtcctttgggaaatcaccagcttg
gcagaacagccttaccaaggcctgtctaatgaacaggtgttgaaatttgtcatggatgga
gggtatctggatcaacccgacaactgtccagagagagtcactgacctcatgcgcatgtgc
tggcaattcaaccccaagatgaggccaaccttcctggagattgtcaacctgctcaaggac
gacctgcaccccagctttccggaggtgtcgttcttccacagcgaggagaacaaggctccc
gagagtgaggagctggagatggagtttgaggacatggagaatgtgcccctggaccgttcc
tcgcactgtcagagggaggaggcggggggccgggatggagggtcctcgctaggtttcaag
cggagctacgaggaacacatcccttacacacacatgaacggaggcaagaaaaacgggcgg
attctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system