KEGG   Pongo abelii (Sumatran orangutan): 100452742Help
Entry
100452742         CDS       T01416                                 

Definition
(RefSeq) histone H2B type F-M-like
  KO
K11252  histone H2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05203  Viral carcinogenesis
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100452742
  Immune diseases
   05322 Systemic lupus erythematosus
    100452742
  Substance dependence
   05034 Alcoholism
    100452742
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100452742
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100452742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF TFIID_20kDa CENP-S TFIID-18kDa
Motif
Other DBs
NCBI-GeneID: 100452742
NCBI-ProteinID: XP_002834738
UniProt: H2PXE3
Position
X
AA seq 253 aa AA seqDB search
MKCHAGSLSANLPALKVTGWSRCVASRQPITVGVCGPKRPLWPSSEKPFNFHTLAKLHDI
GLGNDFLDMTLKAQQQKQKGHATIPKCPRLPWSPTVTLCSCHLMAAASTMAEASSETTSG
ENQSIQEPKEANSTTVQKQKRRGRRGSRRRHANCRGDSFAPYFPRVLKQVHQGLSLSQEA
VSVMDSMVHDILDRIATEAGQLARYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNAA
LRTSLCAIWQQRK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtcacgcagggagcctctcagcaaacctacctgcgttgaaggtgactggatgg
tcccgttgcgtggcatctcgtcaaccaatcacagtgggcgtctgtgggcctaagcgcccc
ttgtggcctagctcggagaaaccgttcaactttcatactttggcaaagctccatgacata
ggcctgggcaatgactttttggatatgaccctgaaagcccagcaacagaagcaaaaaggc
catgcgaccataccaaagtgcccccgccttccctggtccccaacagtcactctctgttct
tgccatctaatggccgctgcctccaccatggctgaggcttcctctgagacaacctcaggg
gaaaaccagagcatccaggagcccaaagaggccaactccacgacggtccagaagcagaag
aggcgaggacgccgaggctcccgcaggcgccacgccaactgccgcggggacagcttcgcc
ccctatttcccccgggtgctgaagcaggttcaccagggcctcagcctttcccaggaggcc
gtgagtgtcatggattctatggtccatgacatattggaccgcatcgccactgaggctggt
cagctggcccgttacaccaagcgcgtgaccatcacctcccgggacatccagatggccgtg
cgcctgctgctgccggggaagatgggcaagctcgccgaggcccagggcacaaatgccgcc
ctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system