KEGG   Pongo abelii (Sumatran orangutan): 100453247
Entry
100453247         CDS       T01416                                 
Symbol
ASCL3
Name
(RefSeq) achaete-scute homolog 3
  KO
K09067  achaete-scute complex protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100453247 (ASCL3)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    100453247 (ASCL3)
SSDB
Motif
Pfam: HLH Cas9-BH
Other DBs
NCBI-GeneID: 100453247
NCBI-ProteinID: XP_002822095
Ensembl: ENSPPYG00000003501
UniProt: H2NE53
Position
11:58171753..58177373
AA seq 181 aa
MMDNRGNSGLPDKLPIFPDSAHLPLTRSFYLEPMVTFHVHPEAPVPSPYSEELPLLPFPS
DSLIPGNYSEPCPFSFPMPYPNYRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
V
NT seq 546 nt   +upstreamnt  +downstreamnt
atgatggacaacagaggcaactctggtctacctgacaaacttcctatcttccccgattct
gcccacttgccactgaccaggtccttctatctggagcccatggtcactttccacgtgcac
ccggaggccccggtgccatccccttactctgaggagctgccactgttgccttttcccagt
gactcccttatcccgggaaattacagtgaaccctgccccttctctttcccgatgccttat
ccaaattacagaaggtgcgagtactcctacgggccagccttcatccggaaaaggaatgag
cgggaaaggcagcgggtgaaatgtgtcaatgaaggctacgcccagctccgccatcatctg
ccagaggagtatttggagaagcgactcagcaaagtggaaactctcagagctgcgatcaag
tacattaactacctgcagtctcttctgtaccctgataaagctgagaccaagaataaccct
ggaaaagtttcctccatgatagcaaccaccagccaccatgctgatcctatgttcagaatt
gtttga

DBGET integrated database retrieval system