KEGG   Pongo abelii (Sumatran orangutan): 100453779Help
Entry
100453779         CDS       T01416                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  Jak-STAT signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04960  Aldosterone-regulated sodium reabsorption
pon04973  Carbohydrate digestion and absorption
pon05100  Bacterial invasion of epithelial cells
pon05142  Chagas disease (American trypanosomiasis)
pon05146  Amoebiasis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  HTLV-I infection
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100453779 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100453779 (PIK3CA)
   04015 Rap1 signaling pathway
    100453779 (PIK3CA)
   04012 ErbB signaling pathway
    100453779 (PIK3CA)
   04370 VEGF signaling pathway
    100453779 (PIK3CA)
   04630 Jak-STAT signaling pathway
    100453779 (PIK3CA)
   04668 TNF signaling pathway
    100453779 (PIK3CA)
   04066 HIF-1 signaling pathway
    100453779 (PIK3CA)
   04068 FoxO signaling pathway
    100453779 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100453779 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100453779 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100453779 (PIK3CA)
   04024 cAMP signaling pathway
    100453779 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100453779 (PIK3CA)
   04152 AMPK signaling pathway
    100453779 (PIK3CA)
   04150 mTOR signaling pathway
    100453779 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100453779 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    100453779 (PIK3CA)
   04218 Cellular senescence
    100453779 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100453779 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100453779 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100453779 (PIK3CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100453779 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100453779 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100453779 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100453779 (PIK3CA)
   04660 T cell receptor signaling pathway
    100453779 (PIK3CA)
   04662 B cell receptor signaling pathway
    100453779 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100453779 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100453779 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100453779 (PIK3CA)
   04062 Chemokine signaling pathway
    100453779 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    100453779 (PIK3CA)
   04923 Regulation of lipolysis in adipocyte
    100453779 (PIK3CA)
   04915 Estrogen signaling pathway
    100453779 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100453779 (PIK3CA)
   04917 Prolactin signaling pathway
    100453779 (PIK3CA)
   04926 Relaxin signaling pathway
    100453779 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100453779 (PIK3CA)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100453779 (PIK3CA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100453779 (PIK3CA)
  Nervous system
   04725 Cholinergic synapse
    100453779 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100453779 (PIK3CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100453779 (PIK3CA)
  Development
   04360 Axon guidance
    100453779 (PIK3CA)
   04380 Osteoclast differentiation
    100453779 (PIK3CA)
  Aging
   04211 Longevity regulating pathway - mammal
    100453779 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100453779 (PIK3CA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100453779 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100453779 (PIK3CA)
   05231 Choline metabolism in cancer
    100453779 (PIK3CA)
   05205 Proteoglycans in cancer
    100453779 (PIK3CA)
   05203 Viral carcinogenesis
    100453779 (PIK3CA)
   05210 Colorectal cancer
    100453779 (PIK3CA)
   05212 Pancreatic cancer
    100453779 (PIK3CA)
   05225 Hepatocellular carcinoma
    100453779 (PIK3CA)
   05226 Gastric cancer
    100453779 (PIK3CA)
   05214 Glioma
    100453779 (PIK3CA)
   05221 Acute myeloid leukemia
    100453779 (PIK3CA)
   05220 Chronic myeloid leukemia
    100453779 (PIK3CA)
   05218 Melanoma
    100453779 (PIK3CA)
   05211 Renal cell carcinoma
    100453779 (PIK3CA)
   05215 Prostate cancer
    100453779 (PIK3CA)
   05213 Endometrial cancer
    100453779 (PIK3CA)
   05224 Breast cancer
    100453779 (PIK3CA)
   05222 Small cell lung cancer
    100453779 (PIK3CA)
   05223 Non-small cell lung cancer
    100453779 (PIK3CA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100453779 (PIK3CA)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100453779 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100453779 (PIK3CA)
   04931 Insulin resistance
    100453779 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100453779 (PIK3CA)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100453779 (PIK3CA)
   05166 HTLV-I infection
    100453779 (PIK3CA)
   05162 Measles
    100453779 (PIK3CA)
   05164 Influenza A
    100453779 (PIK3CA)
   05161 Hepatitis B
    100453779 (PIK3CA)
   05160 Hepatitis C
    100453779 (PIK3CA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100453779 (PIK3CA)
   05169 Epstein-Barr virus infection
    100453779 (PIK3CA)
   05165 Human papillomavirus infection
    100453779 (PIK3CA)
   05146 Amoebiasis
    100453779 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    100453779 (PIK3CA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100453779 (PIK3CA)
   01524 Platinum drug resistance
    100453779 (PIK3CA)
   01522 Endocrine resistance
    100453779 (PIK3CA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100453779 (PIK3CA)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100453779 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC DUF4135 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 100453779
NCBI-ProteinID: XP_024100632
Ensembl: ENSPPYG00000025901
Position
3
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggacctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatctctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatgtacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtttctggaaaa
atggccttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttacttaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcttgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

DBGET integrated database retrieval system