KEGG   Pongo abelii (Sumatran orangutan): 100454155Help
Entry
100454155         CDS       T01416                                 

Gene name
ADH7
Definition
(RefSeq) alcohol dehydrogenase class 4 mu/sigma chain isoform X1
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00071  Fatty acid degradation
pon00350  Tyrosine metabolism
pon00830  Retinol metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100454155 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    100454155 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100454155 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100454155 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100454155 (ADH7)
   00982 Drug metabolism - cytochrome P450
    100454155 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100454155 (ADH7)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100454155 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 100454155
NCBI-ProteinID: XP_002815038
UniProt: A0A2J8TQM7
Position
4
AA seq 386 aa AA seqDB search
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPNDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGAPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLMF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagaaatacagatccaagacaaagacaggatgggcactgctggaaaagttatt
aaatgcaaagcagctgtgctttgggagcagaagcaacccttttccattgaggaaatagaa
gttgccccaccaaagactaaagaagttcgcattaagattttggccacaggaatctgtcgc
acagatgaccatgtgataaaaggaacaatggtgtccaagtttccagtgattgtgggacat
gaggcaactgggattgtagagagcattggagaaggagtgactacagtgaaaccaggtgac
aaagtcatccctctctttctgccacaatgtagagaatgcaatgcttgtcgcaacccagat
ggcaacctttgcattaggagcgatattactggtcgtggagtactggctgatggcaccacc
agatttacatgcaagggcaaaccagtccatcacttcatgaacaccagtacatttactgag
tacacagtggtggatgaatcttctgttgctaagattgatgatgcagctcctcctgagaaa
gtctgtttaattggctgtgggttttccactggatatggggctgctgttaaaactggcaag
gtcaaacctggttccacttgcgtcgtctttggcctgggaggagttggcctgtcagtcatc
atgggctgtaagtcagctggtgcatctaggatcattgggattgacctcaacaaagacaaa
tttgagaaggccatggctgtaggtgccactgagtgtatcagccccaacgactctaccaaa
cccatcagtgaggtgctgtcagaaatgacaggcaacaatgtggggtacacctttgaagtt
attgggcatcttgaaaccatgattgatgccctggcatcctgccacatgaactatgggacc
agcgtggtagtaggagctcctccgtcagccaagatgctcacctatgacccgatgttgctc
ttcactggacgcacgtggaagggatgtgtctttggaggtttgaaaagcagagatgatgtc
ccaaaactagtgactgagttcctggcaaagaaatttgacctggaccagttgataactcat
gttttaccatttaaaaaaatcagtgaaggatttgagctgctcaattcaggacaaagcatt
cgaactgtcctgatgttttga

DBGET integrated database retrieval system