KEGG   Pongo abelii (Sumatran orangutan): 100454614Help
Entry
100454614         CDS       T01416                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100454614 (PLA2G4E)
   00565 Ether lipid metabolism
    100454614 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100454614 (PLA2G4E)
   00591 Linoleic acid metabolism
    100454614 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100454614 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100454614 (PLA2G4E)
   04010 MAPK signaling pathway
    100454614 (PLA2G4E)
   04370 VEGF signaling pathway
    100454614 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100454614 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100454614 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100454614 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100454614 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100454614 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100454614 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100454614 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100454614 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100454614 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100454614 (PLA2G4E)
   04726 Serotonergic synapse
    100454614 (PLA2G4E)
   04730 Long-term depression
    100454614 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100454614 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100454614 (PLA2G4E)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100454614 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100454614
NCBI-ProteinID: XP_002825400
Ensembl: ENSPPYG00000006388
Position
15
AA seq 868 aa AA seqDB search
MSLQASEGCAGLGTNVFVTQSPQRDDEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
NFNFQIQSRVKNVLELSVCDEDTMTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSRLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCCSRKNGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKMVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPEQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPNAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtgctggcctgggaactaatgtgtttgtcacacag
agcccacaaagggatgacgaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgcgggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccactgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
aacttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacaatgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccatgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcccgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgagtcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgctgctctcgcaagaacggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcgactgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaagatggtggtggccaaggccctgaagcaggtgctg
cagttggaggaagacctgcaggaggacgaggtgccgctgatagctatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcactggcctgtcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggcccgg
agacatgtagtaaaggacaagctaccctccctgttcccagagcagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgtctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccatccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccaatcctgcctgaaatcccc
aaatgtgatgctaacatcctagagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctggatggtttcccaaaccagctgacggagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacttgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaacgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccaatgcccccatcgtgact
ttcttcccactcatcaatgatactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacgtacacagaggccacctttgacaagctggtgaaactctcagagtacaac
atcctgaataataaggacactctcctccaggctctgcggcttgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

DBGET integrated database retrieval system