KEGG   Pongo abelii (Sumatran orangutan): 100455260Help
Entry
100455260         CDS       T01416                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X2
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon04350  TGF-beta signaling pathway
pon04520  Adherens junction
pon04630  Jak-STAT signaling pathway
pon04720  Long-term potentiation
pon04916  Melanogenesis
pon04919  Thyroid hormone signaling pathway
pon04922  Glucagon signaling pathway
pon05016  Huntington's disease
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  HTLV-I infection
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05168  Herpes simplex infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100455260 (EP300)
   04330 Notch signaling pathway
    100455260 (EP300)
   04350 TGF-beta signaling pathway
    100455260 (EP300)
   04630 Jak-STAT signaling pathway
    100455260 (EP300)
   04066 HIF-1 signaling pathway
    100455260 (EP300)
   04068 FoxO signaling pathway
    100455260 (EP300)
   04024 cAMP signaling pathway
    100455260 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100455260 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    100455260 (EP300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100455260 (EP300)
   04919 Thyroid hormone signaling pathway
    100455260 (EP300)
   04916 Melanogenesis
    100455260 (EP300)
  Nervous system
   04720 Long-term potentiation
    100455260 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100455260 (EP300)
   05206 MicroRNAs in cancer
    100455260 (EP300)
   05203 Viral carcinogenesis
    100455260 (EP300)
   05211 Renal cell carcinoma
    100455260 (EP300)
   05215 Prostate cancer
    100455260 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    100455260 (EP300)
  Infectious diseases
   05152 Tuberculosis
    100455260 (EP300)
   05166 HTLV-I infection
    100455260 (EP300)
   05164 Influenza A
    100455260 (EP300)
   05161 Hepatitis B
    100455260 (EP300)
   05168 Herpes simplex infection
    100455260 (EP300)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100455260 (EP300)
   05169 Epstein-Barr virus infection
    100455260 (EP300)
   05165 Human papillomavirus infection
    100455260 (EP300)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455260 (EP300)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100455260 (EP300)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100455260 (EP300)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100455260 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 100455260
NCBI-ProteinID: XP_009232690
Ensembl: ENSPPYG00000011862
Position
22
AA seq 2382 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGSGQVMASQAQQNSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPAQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSSLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALN
PPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSP
IMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPNIGAQQPPATTIPAPVPTP
PAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPT
PTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIPEKQPSQEVKMEAKMEVDQ
PEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKK
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKL
DTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGR
KLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTI
NKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKEN
KFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDS
GEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRP
KCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEW
YKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEE
RKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYA
TMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRR
AQWSTICMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKME
KLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQ
MLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPATPQTPQPTSQPQPTPPNSMPPY
LPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQ
IFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWGQGGLPQPQQL
QSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQ
QQQVLSILHANPQLLAAFIKQRAAKYANSNSQPIPGQPGLQPPTMPGQQGVHSNPAMQNM
NPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQ
QQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAE
AGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQP
VPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSM
LSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7149 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggctca
ggtcaagtcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctgcgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatactcagaat
cctggacagcagattggtgccagtggccttggtctccagattcagacaaaaactgtacta
tcaaataacttacctccatttgctatggacaaaaagacagttcctggtggaggaatgccc
aacatgggtcaacagccagccccgcaggtccagcagccaggcctggtcactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcatgctcacaagtgccagcgccgggaacaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacccgttggacttggaaatcct
agctctctaggggtgggtcaacagtctacccccaacctaagcactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcatgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacaccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccggggcctaacatgggacagccgcaacca
ggaatgacttctagtttgaatcaatttggccagatgagcatggcccagccccctattgta
ccccggcaaacccctcctcttcagcaccatggacagttggctcaacctggagctctcaac
ccgcctatgggttatgggcctcgtatgcaacagccttccaaccagggccagttccttcct
cagactcagttcccatcacagggaatgaatgtaacaaatatccctttggctccgtccagc
ggtcaagctccagtgtctcaagcacaaatgtctagttcttcctgcccggtgaactctcct
ataatgcctccagggtctcaggggagccacattcactgtccccagcttcctcaaccagct
ctgcatcagaattcaccctcgcctgtacctagtcgtacccccacccctcaccatactccc
ccaaacataggggctcagcagccaccagcaacaacaattccagcccctgttcctacacct
cctgctatgccacctgggccacagtcccaggctctacatccccctccaaggcagacacct
acaccaccaacaacacaacttccccaacaagtgcagccttcacttcctgctgcaccttct
gctgaccagccccagcagcagcctcgctcacagcagagcacagcagcgtctgttcctacc
ccaacagcaccgttgcttcctccacagcctgcaactccactttcccagccagctgtaagc
attgaaggacaggtatcaaaccctccatctactagtagcacagaagtgaattctcaggcc
attcctgagaagcagccttcccaggaagtgaagatggaggccaaaatggaagtggatcaa
ccagaaccagcagatactcagccggaggatatttcagagtctaaagtggaagactgtaaa
atggaatctaccgaaacagaagagagaagcactgagttaaaaactgaaataaaagaggag
gaagaccagccaagtacttcagctacccagtcatctccggctccaggacagtcaaagaaa
aagattttcaaaccagaagaactacgacaggcactgatgccaacattggaggcactttac
cgtcaggatccagaatcccttccctttcgtcaacctgtggaccctcagcttttaggaatc
cctgattactttgatattgtgaagagccccatggatctttctaccattaagaggaagtta
gacactggacagtatcaggagccctggcaatatgtcgatgatatttggctgatgttcaat
aatgcctggttatataaccggaaaacatcacgggtatacaaatactgctccaagctctct
gaggtctttgaacaagaaattgacccagtgatgcaaagccttggatactgttgtggcaga
aagttggagttctctccacagacactgtgttgctacggcaaacagttgtgcacaatacct
cgtgatgccacttattacagttaccagaacaggtatcatttctgtgagaagtgtttcaat
gagatccaaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaata
aataaagaacaattttccaagagaaaaaatgacacactggatcctgaactgtttgttgaa
tgtacagagtgcggaagaaagatgcatcagatctgtgtccttcaccatgagatcatctgg
cccgctggattcgtctgtgatggctgtttaaagaaaagtgcacgaactaggaaagaaaat
aagttttctgctaaaaggttgccatctaccagacttggcacctttctagagaatcgtgtg
aatgactttctgaggcgacagaatcaccctgagtcaggagaggtcactgttagagtagtt
catgcttctgacaaaaccgtggaagtaaaaccaggcatgaaagcaaggtttgtggacagt
ggagagatggcagaatcctttccgtaccgaaccaaagccctctttgcctttgaagaaatt
gatggcgttgacctatgcttctttggcatgcatgttcaagagtatggctctgactgccct
ccacccaaccagaggagagtatacatatcttacctcgatagtgttcatttcttccgtcct
aaatgcttgaggactgcagtctatcatgaaatcctaattggttatttagaatatgtcaag
aaattaggttacacaacagggcatatttgggcatgtccaccaagtgagggagatgattat
atcttccattgccatcctcctgaccagaagatacccaagcccaagcgactgcaggaatgg
tacaaaaaaatgcttgacaaggctgtatcagagcgtattgtccatgactacaaggatatt
tttaaacaagctactgaagatagattaacaagtgcaaaggaattgccttactttgagggt
gatttctggcccaatgttctggaagaaagcattaaggaactggaacaggaggaagaagag
agaaaacgagaggaaaacaccagcaatgaaagcacagatgtgaccaagggagacagcaaa
aatgctaaaaagaagaataataagaaaaccagcaaaaataagagcagcctgagtaggggc
aacaagaagaaacccgggatgcccaatgtatctaacgacctctcacagaaactatatgcc
actatggagaagcataaagaggtcttctttgtgatccgcctcattgctggccctgccgcc
aactccctgcctcccattgttgatcctgaccctctcattccctgcgatctgatggatggt
cgggatgcctttctcacgctggcaagggacaagcacctggagttctcttcactccgaaga
gcccagtggtccaccatatgcatgctggtggagctgcacacacagagccaggaccgcttt
gtctacacctgcaatgaatgcaagcaccatgtggagacacgttggcactgtactgtctgt
gaggattatgacttgtgtatcacctgctataacactaaaaaccatgaccacaaaatggag
aaactaggtcttggcttagatgatgagagcaacaaccagcaggctgcagccacccagagc
ccaggcgattctcgccgcctgagtatccagcgctgcatccagtctctggtccatgcttgc
cagtgtcggaatgccaattgctcactgccatcctgccagaagatgaagcgggttgtgcag
cataccaagggttgcaaacggaaaaccaatggcgggtgccccatctgcaagcagctcatt
gccctctgctgctaccatgccaagcactgccaggagaacaaatgcccggtgccgttctgc
ctaaacatcaagcagaagctccggcagcaacaactgcagcaccgattacagcaggcccaa
atgcttcgcaggaggatggccagcatgcagcggactggtgtggttgggcagcaacagggc
ctcccttccccaactcctgccactccaacgacaccaactggccaacagccagccaccccg
cagaccccccagcccacttctcagcctcagcctacccctcccaatagcatgccaccctac
ttgcccaggactcaagctgctggacctgtgtcccagggtaaggcagcaggccaggtgacc
cctccaacccctcctcagactgctcagccaccccttccagggccgccacctgcagcagtg
gaaatggcaatgcagattcagagagcagcagagacgcagcgccagatggcccacgtgcaa
atttttcaaaggccaatccaacaccagatgcccccgatgactcccatggcccccatgggt
atgaacccacctcccatgaccagaggtcccagtgggcatttggagccagggatgggaccg
acagggatgcagcaacagccaccctggggccaaggaggattgcctcagccccagcaacta
cagtctgggatgccaaggccagccatgatgtcagtggcccagcatggtcaacccttgaac
atggctccacaaccaggattgggccaggtaggtgtgagcccactcaaaccaggcactgtg
tctcaacaagccttacaaaaccttttgcggactctcaggtctcccagctctcccctacag
cagcaacaggtgcttagtatccttcacgccaacccccagctgttggctgcattcatcaag
cagcgggctgccaaatatgccaactctaattcacaacccatcccggggcagccagggctg
cagccacctaccatgccaggtcagcagggggtccactccaacccagccatgcagaacatg
aatccaatgcaggcgggcgtccagagggctggcctgccccagcagcaaccacagcagcaa
ctccagccacccatgggagggatgagcccccaggctcagcagatgaacatgaaccacaac
accatgccttcacaattccgagacatcttgagacgacagcaaatgatgcaacagcagcag
caacagggagcagggccaggaataggccctggaatggccaaccataaccagttccagcaa
ccccaaggagttggctacccaccacagcagcagcagcagcggatgcagcatcacatgcaa
cagatgcaacaaggaaatatgggacagatgggccagcttccccaggccttgggagcagag
gcaggtgccagtctacaggcctatcagcagcgactccttcagcaacaaatggggtctcct
gctcagcccaaccccatgagcccccagcagcatatgctcccaaatcaggcccagtctcca
cacctacaaggccagcagatccctaattcactctccaatcaagtgcgctctccccagcct
gtcccttctccacggccacagtcccagcccccccactccagcccttccccaaggatgcag
cctcagccttctccacaccacgtttccccacagacaagttccccacatcctggactggta
gctgcccaggccaaccccatggaacaagggcattttgccagcccggaccagaattcaatg
ctttctcagcttgctagcaatccaggcatggcaaacctccatggtgcaagcgccacggac
ctgggactcagcaccgataactcagacttgaattcaaacctctcacagagtacactagac
atacactag

DBGET integrated database retrieval system