KEGG   Pongo abelii (Sumatran orangutan): 100455278Help
Entry
100455278         CDS       T01416                                 

Gene name
EIF3B
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit B isoform X1
  KO
K03253  translation initiation factor 3 subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100455278 (EIF3B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100455278 (EIF3B)
Translation factors [BR:pon03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100455278 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2A RRM_1 ANAPC4_WD40 PALB2_WD40
Motif
Other DBs
NCBI-GeneID: 100455278
NCBI-ProteinID: XP_009240769
Ensembl: ENSPPYG00000017313
Position
7
AA seq 814 aa AA seqDB search
MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTKASSEEVGVAEA
GPELEVRTEPAAEAEAASGPSESPSPPASEEPPGSHAEPPAPTQGEAPGEQARDERSDSR
AQAASEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggagaacgtggcggtgcccgaggcggccgaggagcgcgccgagcccggt
cagcagcagccggccgccgagccgccgccagccgaggggctgctgcgacccgcggggcct
ggcgctccggaggcggcggggaccaaggcctccagtgaggaggtgggggtcgcggaggcc
gggccggagcttgaggtgaggaccgagccggcggccgaggcagaggcggcctccggcccg
tctgagtcgccctcgccgccggcctccgaggagccgcccgggtcgcatgctgagccccct
gccccgacacagggcgaggccccaggagagcaggctcgggacgagcgctccgacagccgg
gcccaggcggcgtccgaggacgcgggaggaaacgagggcagagcggccgaggccgaaccc
cgggctctggagaacggcgacgcggacgagccctccttcagcgaccccgaggacttcgtg
gacgacgtgagcgaggaagaattactgggagatgtactcaaagaccggccccaggaagca
gatggaatcgattcggtgattgtagtggacaatgtccctcaggtgggaccagaccgactt
gagaaactcaaaaatgtcatccacaagatcttttccaagtttgggaaaatcacaaatgat
ttttatcctgaagaggatgggaagacaaaagggtatattttcctggagtacgcgtctcct
gcccacgctgtggatgccgtgaagaacgccgacggctataagcttgacaagcagcacacg
ttccgggtcaacctcttcacggattttgacaagtatatgaccatcagtgacgagtgggat
attccagagaaacagcctttcaaagacctggggaacttacgttactggcttgaagaggca
gaatgcagagatcagtacagtgtgatttttgagagtggagaccgcacttccatattctgg
aatgacgtaaaagaccctgtctcaattgaagaaagagcgagatggacagagacgtatgtg
cgttggtctcctaagggcacctacctggctacctttcatcaaagaggcattgctctatgg
gggggagagaaattcaagcaaattcagagattcagccaccaaggggttcagctcattgac
ttctcaccttgtgaaaggtacctggtgacctttagccccctgatggacacgcaggatgac
cctcaggccataatcatctgggacatccttacggggcacaagaagaggggttttcactgt
gagagctcagcccattggcctatttttaagtggagccatgatggcaaattctttgccaga
atgaccctggatacgcttagcatctatgaaactccttctatggggcttttggacaagaag
agtttgaagatctccgggataaaagacttttcttggtctcctggtggtaacataatcgcc
ttctgggtgcctgaagacaaagatattccagccagggtaactctgatgcagctccctacc
aggcaagagatccgagtgagaaacctgttcaatgtggtggactgcaagctccattggcag
aagaacggagactacttgtgtgtgaaagtagataggactccgaaaggcacccagggtgtt
gtcacaaattttgaaattttccgaatgagggagaaacaggtacctgtggatgtggtcgaa
atgaaagaaaccatcatagcctttgcctgggaaccaaatggaagtaagtttgctgtgctg
cacggagaggctccgcggatatctgtgtctttctaccacgtcaaaaacaacgggaagatt
gaactcatcaagatgttcgacaagcagcaggcaaacaccatcttctggagcccccaagga
cagttcgtggtgttggcgggcctgaggagtatgaacggtgccttagcgtttgtggacact
tcggactgcacggtcatgaacatcgcagagcactacatggcttccgacgtcgaatgggat
cctactgggcgctacgtcgtcacctctgtgtcctggtggagccataaggtggacaacgcg
tactggctgtggactttccaggggcgcctcctgcagaagaacaacaaagaccgcttctgc
cagctgctgtggcggccccggcctcccacactcctgagccaggagcagatcaagcaaatt
aaaaaggatctgaagaaatactctaagatctttgaacagaaggatcgtttgagtcagtcc
aaagcctcaaaggaattggtggagagaaggcgcaccatgatggaagatttccggaagtac
cggaaaatggcccaggagctctatatggagcagaaaaacgagcgcctggagttgcgagga
ggggtggacactgacgagctggacagcaacgtggacgactgggaagaggagaccattgag
ttcttcgtcactgaagaaatcatccccctcgggaatcaggagtga

DBGET integrated database retrieval system