KEGG   Pongo abelii (Sumatran orangutan): 100455401
Entry
100455401         CDS       T01416                                 
Symbol
ATOH1
Name
(RefSeq) protein atonal homolog 1
  KO
K09083  atonal protein 1/7
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100455401 (ATOH1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    100455401 (ATOH1)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 100455401
NCBI-ProteinID: XP_002832849
UniProt: H2PF02
Position
4:92315846..92317013
AA seq 354 aa
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQARQHPVYPPELSLLDSTD
PRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEADGRGELVRRSSGGASSSKSPG
PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFD
QLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRT
AASYEGGAGNATATGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS
ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtcccgcctgctgcatgcagaagagtgggctgaagtgaaggagttgggagaccaccat
cgccagccccagccgcatcatctcccgcaaccgccgccgccgccacagccacctgcaact
ttgcaggcgagacagcatcccgtctacccgcctgagctgtccctcctggacagcaccgac
ccacgcgcctggctggctcccactttgcagggcatctgcacggcacgcgccgcccagtat
ttgctacattccccggagctgggtgcctcggaggccgctgcgccccgggacgaggcggac
ggccgcggggagctggtaaggaggagcagcggcggtgccagcagcagcaagagccccggg
ccggtgaaagtgagggaacagctgtgcaagctgaaaggcggggtggtggtagacgagctg
ggctgcagccgccaacgggccccttccagcaaacaggtgaatggggtgcagaagcagaga
cggctagcagccaacgccagggagcggcgcaggatgcacgggctgaaccacgccttcgac
cagctgcgcaatgttatcccgtccttcaacaacgacaagaagctgtccaaatatgagacc
ctgcagatggctcaaatctacatcaacgccttgtccgagctgctacaaacgcccagcggt
ggggaacagccaccgccgcctccagcctcctgcaaaagcgaccaccaccaccttcgcacc
gccgcctcctatgaagggggcgcgggcaacgcgactgcaactggggctcagcaggcttcc
ggagggagccagcggccgaccccgcccgggagttgccggactcgcttctcagctccggcc
tctgcgggagggtactcggtgcagctggacgctctgcacttctcgactttcgaggacagc
gccctgacagcgatgatggcgcaaaagaatttgtctccttcgctccccgggagcatcttg
cagccagtgcaggaggaaaacagcaaaacttcgcctcggtcccacagaagcgacggggaa
ttttccccccattcccattacagtgactcggatgaggcaagttag

DBGET integrated database retrieval system