KEGG   Pongo abelii (Sumatran orangutan): 100455627Help
Entry
100455627         CDS       T01416                                 

Gene name
COMT
Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon00350  Tyrosine metabolism
pon01100  Metabolic pathways
pon04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100455627 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100455627 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100455627 (COMT)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100455627 (COMT)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100455627 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI Methyltransf_15 PCMT Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 100455627
NCBI-ProteinID: XP_024096009
Ensembl: ENSPPYG00000011588
Position
22
AA seq 271 aa AA seqDB search
MLEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFVLQPIYNLLMGDTKEQRIL
HHVLQHAEPGNAESVLEAIDTYCEQKEWAMNVGKKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLLTIEINPDFAAVTQRMVDFAGVQDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSRFE
CTHYQSFLEYRQVVDGLEKAIYKGPGSEAGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccgcctctgctgctggcagctgtgttgctgggcctggtgctgctggtg
gtgctgctgctgctcctgaggcactggggctggggcctgtgccttattggctggaacgag
ttcgtcctgcagcccatctacaacctgctcatgggtgacaccaaggagcagcgcatcctg
caccacgtgctgcagcatgcggagcccgggaatgcagagagtgtgctggaggccatcgac
acctactgcgagcagaaggagtgggccatgaacgtgggcaagaagaaaggcaagatcgtg
gacgccgtgattcaggagcaccagccctccgtgctgctggagctgggggcctactgtggc
tactcagctgtgcgcatggcccgcctgctgtcaccaggggcgaggctgctcaccatcgag
atcaaccctgacttcgccgccgtcacccagcggatggtggatttcgctggcgtgcaggac
aaggtcacccttgtggttggggcgtcccaggacatcattccccagctgaagaagaagtat
gacgtggacacgctggacatggtcttcctcgaccactggaaggaccggtacctgccggac
acgcttctcctggaggaatgtggcctgctgcggaaggggacagtgctactggctgacaac
gtgatctgcccaggtgcaccagacttcctagcacacgtgcgcgggagcagccgctttgag
tgcacacactaccaatcgttcctggaatacaggcaggtggtggacggcctggagaaggcc
atctacaagggcccaggcagcgaagcagggccctga

DBGET integrated database retrieval system