KEGG   Pongo abelii (Sumatran orangutan): 100457486
Entry
100457486         CDS       T01416                                 

Gene name
KAT7
Definition
(RefSeq) histone acetyltransferase KAT7 isoform X1
  KO
K11307  histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100457486 (KAT7)
   03036 Chromosome and associated proteins [BR:pon03036]
    100457486 (KAT7)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100457486 (KAT7)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    100457486 (KAT7)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100457486 (KAT7)
   HAT complexes
    HBO1 complex
     100457486 (KAT7)
SSDB
Motif
Pfam: MOZ_SAS zf-MYST zf-C2HC Acetyltransf_7 zf-met
Other DBs
NCBI-GeneID: 100457486
NCBI-ProteinID: XP_009234870
UniProt: A0A663D9W0 H2NVL2
Position
17
AA seq 611 aa
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgttcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatttgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaagtaccctcttcggcagactcgttcatct
ggctcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccgcctcgaactccaactggaaacgcaccttcttctgagtctgacata
gacatctccagccccaatgtgtctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactgtatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtctcacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacggagaggcagcttcgatat
aaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagaacagaaa
gagaaatatatggaacacagacagacctatgggaacacacgggaacctcttttagaaaac
ctgacaagcgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaagttaaggctgcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacctggtaccattctccatatcctgaagaatatgca
cggctgggacgtctctatatgtgtgaattctgtttaaaatatatgaagagccaaacgata
ctccgccggcacatggccaaatgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaaactttttctggaccacaagacattatattatgatgtggagccc
ttcctgttctatgttatgacagaggcggacaacactggctgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaacgtatcctgtatccttactatgcctcag
tacatgagacagggctatggcaagatgcttattgatttcagttatttgctttccaaagtc
gaagaaaaagttggctccccagaacgtccactctcagatctggggcttataagctatcgc
agttattggaaagaagtacttctccgctacctgcataatttccaaggcaaagagatttct
atcaaagaaatcagtcaggagacagctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtactggaagggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaaggtccaactccaataaaaccatggatccc
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system