KEGG   Pongo abelii (Sumatran orangutan): 100459799Help
Entry
100459799         CDS       T01416                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04720  Long-term potentiation
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04921  Oxytocin signaling pathway
pon04931  Insulin resistance
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05168  Herpes simplex infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100459799 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100459799 (PPP1CA)
   04024 cAMP signaling pathway
    100459799 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    100459799 (PPP1CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100459799 (PPP1CA)
   04218 Cellular senescence
    100459799 (PPP1CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100459799 (PPP1CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100459799 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100459799 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    100459799 (PPP1CA)
   04921 Oxytocin signaling pathway
    100459799 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100459799 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100459799 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    100459799 (PPP1CA)
   04720 Long-term potentiation
    100459799 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100459799 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100459799 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    100459799 (PPP1CA)
   05034 Alcoholism
    100459799 (PPP1CA)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100459799 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    100459799 (PPP1CA)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100459799 (PPP1CA)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100459799 (PPP1CA)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100459799 (PPP1CA)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100459799 (PPP1CA)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100459799 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100459799
NCBI-ProteinID: XP_002821493
Ensembl: ENSPPYG00000002995
UniProt: A0A2J8U0C7
Position
11
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactcgatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggcaagaatgtacagctgacagagaacgagatccgcggtctgtgcttg
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacatacacggccagtactacgaccttctgcgactatttgagtatggcggt
ttccctcccgagagcaactacctctttctgggggactatgtggacaggggcaagcagtcc
ttggagaccatctgcctgctgctggcgtataagatcaagtaccccgagaacttcttcttg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctatggtttctacgatgagtgc
aagagacgctacaacatcaaactgtggaaaaccttcactgactgcttcaactgcctgccc
atcgcagccatagtggacgaaaagatcttctgctgccacggaggcctgtccccggacctg
cagtctatggagcagattcggcggatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggcgtctcttttacctttggagccgaggtggtggccaagttcctccacaagcacgac
ttggacctcatctgccgagcacaccaggtggtagaagatggctatgagttctttgccaag
cggcagctggtgacacttttctcagctcccaactactgtggcgagtttgacaatgctggc
gccatgatgagcgtggacgagaccctcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaagtacgggcagttcagtggcctgaaccctggaggccgacccatcacc
ccaccccgcaattccgccaaagccaagaaatag

DBGET integrated database retrieval system