KEGG   Pongo abelii (Sumatran orangutan): 100459989Help
Entry
100459989         CDS       T01416                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon00240  Pyrimidine metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100459989 (DCK)
   00240 Pyrimidine metabolism
    100459989 (DCK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100459989 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33 AAA_28 CoaE
Motif
Other DBs
NCBI-GeneID: 100459989
NCBI-ProteinID: XP_002814884
Ensembl: ENSPPYG00000014814
UniProt: H2PDJ3
Position
4
AA seq 260 aa AA seqDB search
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAKWCN
VQSTQNKFEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYESLVEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaggggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaattgtgtgaagattgggaagtggttcctgaacctgttgccaaatggtgcaat
gttcaaagtactcaaaataaatttgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctgaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgagacagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacatgaaagctggctcctgcataggaca
ctgaaaaccaacttcgattatcttcaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagacaaatatgaaagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system