KEGG   Pongo abelii (Sumatran orangutan): 100460185Help
Entry
100460185         CDS       T01416                                 

Gene name
ATF7IP
Definition
(RefSeq) activating transcription factor 7-interacting protein 1 isoform X6
Organism
pon  Pongo abelii (Sumatran orangutan)
SSDB OrthologParalogGFIT
Motif
Pfam: ATF7IP_BD
Motif
Other DBs
NCBI-GeneID: 100460185
NCBI-ProteinID: XP_009245773
Ensembl: ENSPPYG00000004318
Position
12
AA seq 1131 aa AA seqDB search
MHQDQRFRMDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGD
LDPTSPLENMDYIKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPL
SPHNITSEPDSKLTAEPVSGDPAPGDLDAGDPASGVLASGDSTSGDPTSSEPSSSDAASG
DATSGDAASGDVSPGDATSGDATADDLSSGDPTSSDPIPGELVPVEPISGDCVADDIASS
EITSVDLASGAPTSTDPGSDDLAPGDLSSSELASDDLATGELASDELTSESTFDRTFEPN
SVPVCEPVPEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLNEKNKADNNIDANEETP
ETDDTTICSDRPPENEKKVEEGNITELALGEDAISSSMEIDQGEKNEDETSADLVETINE
NVIEDDKSENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKME
SSFGSPSKQESSESLPKEAFLVLSDEEDISGEKDESEVISQNEMCSPAETESNEKDNKPE
EEEQVIHEEDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDIN
QKLQKVIQWLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKR
FEAAKEDLKKRHEHPPNPPVSPGKTVNDINSNNNMSYRNAGTVRQMLESKRNVSESAPPS
FQTPVNTVSSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTAAVVATTQVPSGNP
QPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNP
VSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTV
GPSGLYSPSTNRGPIQMKIPISAFSTSSPAEQNSNTTPRIENQTNKTIDASVSKKAADST
SQSGKATGSDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPL
QPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPA
QAPLRGTVMQAPAVRQVNPQNRELNRENCSCILVDLCSECCLQFNFIYGLY
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggaccagagattcagaatggacagtttagaagaacctcagaaaaaagtcttt
aaggctcgaaaaacgatgagagtgagtgatcgtcagcaacttgaagcagtgtacaaggtc
aaagaagaactgttgaaaactgatgtcaagctgttaaatggcaaccatgaaaatggagat
ttggacccaacctcacctttggaaaatatggattacattaaagacaaggaagaggtgaat
ggcattgaagagatttgttttgatcctgaaggaagtaaagcagaatggaaagaaacaccc
tgtatcctaagtgttaatgtaaaaaacaagcaggatgatgatttaaattgtgaacctttg
tctccccataatataacttcagaaccagactctaaactgactgctgaaccagtttctggt
gatccagcccctggtgatctggatgccggagatccagcctccggagtactggcctctggt
gattccacctctggtgatcccacctctagcgagccctcctctagtgatgctgcctctggt
gatgcaacctctggtgatgccgcttctggtgatgtgtcccctggtgatgccacctctggt
gatgccactgctgatgatctctcctctggtgatcccacctctagtgatcccatcccaggt
gaactggtccctgttgaacccatttctggtgattgtgtcgctgatgatatagcctctagt
gaaataacttctgttgatctggcttctggagcaccaacttccactgatccaggctctgat
gatctggcccctggtgatctatcctctagtgaactggcctctgatgatctggccactggt
gaactggcctctgatgagctgacttctgaatcaaccttcgatcgtacctttgaaccaaat
tctgtaccagtttgtgaaccagttcctgaaattgacaatatagaaccaagtagcaataaa
gatgatgattttcttgaaaaaaatggggctgatgaaaaattagagcaaattcagagtaaa
gactcattgaacgagaaaaataaagctgataataatattgatgctaatgaagaaactcca
gaaacagatgatacaactatttgttcagatcgacctcctgaaaatgaaaagaaggtagag
gaaggtaatatcacagagcttgctcttggagaagatgctatatctagcagtatggaaatt
gaccaaggtgaaaagaatgaagatgaaacttctgcagatcttgtagaaacgattaatgaa
aatgttattgaagatgacaaaagtgagaatatcttagaaaatacagactctatggagaca
gatgaaatcattcctattttggaaaagctcgcaccttctgaggatgaacttacttgcttt
tctaaaacatctctccttccaatcgatgagacaaatccagatttggaagagaaaatggaa
agttcttttggttcaccatctaaacaagaaagtagtgagagtttgccaaaagaagccttt
ctggtcctctctgatgaagaagatatttcaggtgaaaaagatgagtctgaagttatatcg
caaaatgaaatgtgctctccagcagaaacagaaagtaatgaaaaagacaacaaacctgag
gaagaagagcaagtaatacatgaagaagatgaaagaccttctgagaaaaatgaattttct
agacgaaaacgttctaaatcagaagacatggacaatgtacagtctaaacgtcgtcgatat
atggaagaagaatatgaggcagaatttcaagtaaagattacagccaaaggggacattaac
cagaaacttcaaaaggttatacagtggttgctggaagaaaaattgtgtgcactgcagtgt
gctgtatttgataagactttggcagaattgaaaacacgagtggaaaagattgaatgtaac
aagaggcataaaacagttctcactgaactacaggccaagatagccaggttaaccaaacgc
tttgaagcagccaaagaagatcttaagaaaagacatgaacatccacccaacccaccagta
tcaccaggaaaaactgtaaatgatatcaacagcaataataacatgtcttacagaaatgca
ggcacagtgagacagatgctggagtccaaaagaaatgtaagcgagagtgcaccaccatcc
tttcaaactcctgtgaatacagtatcttcaaccaatcttgtcactcctccagcagttgtc
agtagtcaacctaaattgcagactccagtgacttcgggttcccttacagcaacgtcagtt
cttcctgcacccaatacagctgctgtagttgctactactcaggtgcctagtggaaatccc
cagcctacaatctctttacaacctttgccagtgattttgcatgtacctgttgcagtatcc
tcccagcctcagcttctacagagccatccagggactttggtgactaatcaaccatctggc
aacgttgaattcatttctgtgcaaagcccacctacagtgagtggtcttaccaaaaatcca
gtatccttgccatccttgccaaatcccactaaaccaaacaacgttccttctgtgcccagt
cctagtattcaaaggaaccctactgccagtgctgcaccattgggaacaacacttgctgtg
caggctgttccaacggcacactctattgtacaagccacaaggacttctttacccacagtg
ggcccatcaggactctatagtccatcaactaatcgaggtcctatacagatgaaaattcca
atttctgcatttagtacttcgtctcctgcagaacagaacagcaataccaccccaagaatt
gaaaaccagacaaacaaaacaatagatgcttctgtcagtaagaaagcagctgatagcaca
tcacagagtggaaaagccactggcagtgattcaagtggtgtcattgatctcacaatggat
gatgaagagagtggagcttcacaagaccccaaaaagctaaatcacactcctgtatcaacc
atgagttcttctcagcctgtgtcacgaccattgcaacccatacaaccagcaccgcctctt
caaccatctggggtgccaacaagtggaccatctcagaccaccatacacttactacctaca
gctccaactaccgtgaatgtaacacatcgtccagtaactcaggtgaccacaagactccct
gtaccaagagctcctgcaaaccaccaggtggtttatacaactcttcctgcaccaccagct
caggctcccttgcgaggaactgttatgcaggctcctgctgttcggcaggtcaatccccaa
aatagagagttaaacagagaaaattgttcatgtatactagttgatttgtgctctgagtgt
tgtcttcaatttaactttatttatggcctgtattag

DBGET integrated database retrieval system