KEGG   Pongo abelii (Sumatran orangutan): 100460247Help
Entry
100460247         CDS       T01416                                 

Gene name
OTUD5
Definition
(RefSeq) OTU domain-containing protein 5 isoform X2
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100460247 (OTUD5)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100460247 (OTUD5)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C85
   100460247 (OTUD5)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    100460247 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTU Peptidase_C65
Motif
Other DBs
NCBI-GeneID: 100460247
NCBI-ProteinID: XP_009233106
Position
X
AA seq 566 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALA
KPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactatactccccaaaaagaagccgccgcctcccgacgccgaccccgccaacgagccg
ccgccgcccgggccgctgcccccggcgccgcggcgcggcgggggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggcggcgatcgcgaccgtgactccggcgtcgtgggggcccgt
ccgcgagcttcgccaccgcctcaaggcccgctaccaggaccgccgggcgctcttcatcgc
tgggcgctggccgtgccgcctggtgcagtggcgggtccccggccccaacaggcttctcca
cctccttgcgggggcccaggtggtcccggcggcggtcccggcgacgcgctgggcgcagcg
gcggcgggtgtgggtgccgcgggcgtggtggtgggtgtgggtggtgccgtaggcgtgggc
ggctgctgctccgggcctgggcacagcaagcggcgacgtcaagctcctggggttggcgcg
gttggcgggggcagtcccgagcgtgaggaggtcggcgcaggctacaacagtgaggacgag
tatgaggcggctgcagcacgcatcgaggctatggaccctgccactgtcgagcagcaggag
cattggtttgaaaaggccctacgagacaagaagggcttcatcatcaagcagatgaaggag
gatggtgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgccgactacttctccaac
tatgtcacagaggactttaccacctacattaacaggaagcggaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccgtcctgtggaggtgtaccag
tacagcacagaacccatcaacacattccatgggatacatcaaaacgaggatgaacccatt
cgtgttagctaccatcggaatatccactataattcagtggtgaatcctaacaaggccacc
attggtgtggggctgggcctgccatcattcaaaccagggtttgcagagcagtctctgatg
aagaatgccataaaaacatcggaggagtcatggatcgaacagcagatgctagaagacaag
aaacgggccacggactgggaggccacaaatgaggccatcgaggagcaggtggctcgggaa
tcctacctgcagtggttgcgggatcaggagaaacaagctcgccaggtccgaggccccagc
cagccccggaaagccagcgccacatgcagttcggccacagcagcagcctccagtggcctg
gaggagtggactagccggtctccgcggcagcggagttcagcctcgtcacctgagcaccct
gagctgcatgctgaattgggcatgaagcccccttccccaggcactgttttagctcttgcc
aaacctccttcgccctgtgcgccaggtacaagcagtcagttctcggcaggggccgaccgg
gcaacttccccccttgtgtccctctaccctgctttggagtgccgggccctcattcagcag
atgtccccctctgcctttggtctgaatgactgggatgatgatgagatcctagcgtcggtg
ctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagac
ccgcccccagacaagagttga

DBGET integrated database retrieval system