KEGG   Pongo abelii (Sumatran orangutan): 100460806
Entry
100460806         CDS       T01416                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100460806 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100460806 (ADCY4)
   04371 Apelin signaling pathway
    100460806 (ADCY4)
   04020 Calcium signaling pathway
    100460806 (ADCY4)
   04072 Phospholipase D signaling pathway
    100460806 (ADCY4)
   04024 cAMP signaling pathway
    100460806 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100460806 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100460806 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100460806 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100460806 (ADCY4)
   04062 Chemokine signaling pathway
    100460806 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100460806 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100460806 (ADCY4)
   04912 GnRH signaling pathway
    100460806 (ADCY4)
   04913 Ovarian steroidogenesis
    100460806 (ADCY4)
   04915 Estrogen signaling pathway
    100460806 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100460806 (ADCY4)
   04921 Oxytocin signaling pathway
    100460806 (ADCY4)
   04926 Relaxin signaling pathway
    100460806 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100460806 (ADCY4)
   04918 Thyroid hormone synthesis
    100460806 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100460806 (ADCY4)
   04916 Melanogenesis
    100460806 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100460806 (ADCY4)
   04927 Cortisol synthesis and secretion
    100460806 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100460806 (ADCY4)
   04270 Vascular smooth muscle contraction
    100460806 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100460806 (ADCY4)
   04971 Gastric acid secretion
    100460806 (ADCY4)
   04972 Pancreatic secretion
    100460806 (ADCY4)
   04976 Bile secretion
    100460806 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100460806 (ADCY4)
   04727 GABAergic synapse
    100460806 (ADCY4)
   04725 Cholinergic synapse
    100460806 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100460806 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100460806 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100460806 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100460806 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100460806 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100460806 (ADCY4)
   04714 Thermogenesis
    100460806 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460806 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100460806 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100460806 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100460806 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100460806 (ADCY4)
   05163 Human cytomegalovirus infection
    100460806 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100460806 (ADCY4)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100460806 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100460806
NCBI-ProteinID: XP_009247254
Ensembl: ENSPPYG00000005702
Position
14
AA seq 883 aa
MERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSR
PESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHEC
MRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSV
LCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDP
YLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHL
SHGDSPVSTSTPLPEKTLASFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQW
KQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAI
TYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLV
FAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSL
FLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAI
SFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQF
IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLS
KPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDIIN
KHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAW
ALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 2652 nt   +upstreamnt  +downstreamnt
atggagcgcgccctgcgggccacgttccgggaggcactcagctccctgcactcacgccgg
cggctggacaccgagaagaagcaccaggaacaccttctcttatccatccttcctgcctac
ctggcccgagagatgaaggcagagatcatggcacggctgcaggcaggacaggggtcacgg
ccagagagcaccaacaatttccacagcctctatgtcaagaggcaccagggagtcagcgtg
ctgtatgctgacatcgtgggcttcacacggctggccagcgagtgttcccctaaggagctg
gtgctcatgctcaatgagctctttggcaagttcgaccagatcgccaaggagcatgaatgc
atgcggatcaagatcctgggggactgttactactgtgtctccgggctgccactctcactg
ccagaccatgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaaa
ctgcgggcagctactggcgtggacatcaacatgcgtgtgggcgtgcactcaggcagcgta
ctgtgtggagtcatcgggctgcagaagtggcagtacgacgtttggtcccatgatgtcaca
ctggctaaccacatggaggcaggcggtgtaccagggcgagtgcacatcacaggggctacc
ctggccctgctggcaggggcttatgctgtggaggacgcaggcatggagcatcgggaccct
taccttcgggagctaggggagcctacctatctggtcatcgatccacgggcagaggaggag
gatgagaagggcactgcaggaggcttgctgtcctcgcttgagggcctcaagatgcgtcca
tcactgctgatgacccgttacctggagtcctggggcgcagccaagccttttgcccacctg
agccacggagacagccctgtgtccacctccacccctctcccggagaagaccctggcttcc
ttcagcccccagtggagcctggatcggagccgtaccccccggggactagatgatgaactg
gacaccggggatgccaagttcttccaggtcattgagcagctcaactcgcagaaacagtgg
aagcagtcgaaggacttcaacccactgacactgtacttcagagagaaggagatggagaaa
gagtaccgactctctgcaatccccgccttcaaatactatgaagcttgcaccttcctggtt
tttctctccaacttcatcatccagatgctagtgacaaacaggcccccagctctggcgatc
acgtatagcatcaccttcctcctcttcctcctcatcctttttgtctgcttctcagaggac
ctgatgaggtgtgtcctgaaaggccccaagatgctgcactggctgcctgcactgtctggc
ctggtggccacacgaccaggactgagaatagccttgggcaccgccaccatcctccttgtc
tttgccatggccattaccagcctgttcttcttcccaacatcatcagactgccctttccaa
gctcccaatgtgtcctccatgatttccaacctctcctgggagctccctgggtctctgcct
ctcatcagtgtcccatactccatgcactgctgcacactgggcttcctctcctgctccctg
tttctgcacatgagcttcgagctgaagctgctgctgctcctgctgtggctggcggcatcc
tgctccctcttcctgcactcccacgcctggctgtctgaatgtctcatcgtccgcctctat
ctgggccccttggactccaggcccggagtgctgaaggagcccaaactgatgggtgctatc
tccttcttcatcttcttcttcaccctccttgtcctggctcgccagaatgagtactactgc
cgcctggacttcctgtggaagaagaagctgaggcaggagcgggaggagacagagacgatg
gagaacctgactcggctgctcttggagaacgtgctccctgcacacgtggccccccagttc
attggccagaaccggcgcaacgaggatctctaccaccagtcctacgaatgcgtttgtgtc
ctcttcgcctcagtcccagacttcaaggagttctactctgaatccaacatcaatcatgag
ggcctagagtgtctgaggctgctcaatgagataattgctgattttgatgagctgctctcc
aagcccaagttcagtggggtggagaagatcaagaccatcggcagcacctacatggcagcc
acaggcttaaatgccacctctggacaggatgcacaacaggatgctgaacggagctgcagc
caccttggcactatggtggaatttgccgtggccctggggtctaagctggacatcatcaac
aagcattcattcaacaacttccgcctgcgtgtggggttgaaccatggaccagtagtagct
ggagttattggggcccagaagccgcaatatgacatttggggcaacacagtgaacgtggcc
agccgcatggagagtacaggagtccttggcaaaatccaagtgactgaggagacagcatgg
gccctacagtccctgggctacacctgctacagccggggtgtcatcaaggtgaaaggcaaa
gggcagctctgcacctacttcctgaacacagacttgacacgaactggacctccttcagct
accctaggctga

DBGET integrated database retrieval system