KEGG   Pongo abelii (Sumatran orangutan): 100460918Help
Entry
100460918         CDS       T01416                                 

Gene name
GUCY2C
Definition
(RefSeq) heat-stable enterotoxin receptor
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100460918 (GUCY2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460918 (GUCY2C)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100460918 (GUCY2C)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100460918 (GUCY2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor LapA_dom
Motif
Other DBs
NCBI-GeneID: 100460918
NCBI-ProteinID: XP_002823018
Ensembl: ENSPPYG00000004320
UniProt: H2NGP2
Position
12
AA seq 1073 aa AA seqDB search
MNTLLLDLALWSLLFQAGGLSWSSQVSQNCHNGSYEISVLMMDNSAFAEPLENLEDAVNE
GLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAKRMGCVLI
GPSCTYSTFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLTYFLVNFWKTNDL
PFKTYSWSTSYVYKNGTETEDCFWYLNALEAGVSYFSHELSFKAVLRQDKEFQDILTDHN
RKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQYFEGNVTAPDYMKNVLVLTLS
PGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLMIFLENGENITTPKFAHAFRNLTF
EGYDGPVTLDDWGDVDSTMMLLYTSVDTKKYKVLLTYDTHVNQTNPVDMSPTFTWKNSKL
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYKKDYELRQKKWSHIPPENIFPLE
TNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQ
RLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTDKESTYF
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgttgctgttggacttggctttgtggtcactgcttttccaggccggggggctg
tcctggagttcccaggtgagtcagaactgccacaatggcagctatgaaatcagcgtcctg
atgatggacaactcagcctttgcagagcccctggaaaacttggaagatgcggtgaatgag
gggctggaaatagtgagaggacgtctgcaaaatgctggcctaaatgtgactgtgaacgct
actttcatgtattcggatggtctgattcataactcaggcgactgccggagtagcacctgt
gaaggcctcgacctactcaggaaaatttcaaatgcaaaacggatgggctgtgtcctcata
gggccctcatgtacatactccaccttccagatgtaccttgacacagaattgagctacccc
atgatctcagctggaagttttggattgtcatgtgactataaagaaaccttaaccaggctg
atgtctccagctagaaagttgacgtacttcttggttaacttttggaaaaccaatgatctg
cccttcaaaacttattcctggagcacttcatatgtttacaagaatggtacagagactgag
gactgtttctggtaccttaatgctctggaggctggcgtttcctatttctcccacgaactc
agctttaaggcggtgttaagacaagataaggagtttcaggatatcttaacagaccacaac
aggaaaagcaatgtgattattatgtgtggtggtccagagttcctctacaagctgaagggt
gaccgagcagtggctgaagacattgtcattattctagtggatcttttcaatgaccagtac
tttgagggcaatgtcacagcccctgactatatgaaaaatgtccttgttctgacgctgtct
cctgggaattccctcctaaatagctctttctccaggaatctatcacctacaaaacgagac
tttgctcttgcctacttgaatggaatcctgctctttggacatatgctgatgatatttctt
gaaaatggagaaaatattaccacccccaaatttgctcatgctttcaggaatctcactttt
gaagggtatgacggtccagtgaccttggatgactggggggatgttgacagtaccatgatg
cttctgtatacctctgtggacaccaagaaatacaaggttcttttgacctatgatacccac
gtaaatcagaccaatcctgtggatatgagccccaccttcacttggaagaactctaaactt
cctaatgatattacaggccggggccctcagatcctgatgattgcagtcttcaccctcact
ggagctgtggtgctgctcctgctcgtcgctctcctgatgctcagaaaatataaaaaagat
tatgaacttcgtcagaaaaaatggtcccacattcctcctgaaaatatctttcctctggag
accaatgagaccaaccatgttagcctgaagatcgatgatgacaaaagacgagatacaatc
cagagactacgacagtgcaaatacgacaaaaagcgagtgattctcaaagatctcaagcac
aatgatggtaatttcactgaaaaacagaagatagaactgaacaagttgcttcagatagac
tattacaacctgaccaagttctacggcacagtgaaacttgataccatgatcttcggggtg
atagaatactgtgagagaggatccctccgggaagttttaaatgacacaatttcctatcct
gatggtacattcatggattgggagtttaagatctctgtcttgtatgacattgctaaggga
atgtcatatctgcactccagtaagacagaagtccatggtcgtctgaaatctaccaactgc
gtagtggacagtagaatggtggtaaagatcactgattttggctgcaattccattttacct
ccaaaaaaagacctgtggacagctccagagcacctccgccaagccaacatctctcagaaa
ggagatgtgtacagctatgggatcatcgcacaggagatcatcctgcggaaggaaaccttc
tacactttgagctgtcgggaccgcaatgagaagattttcagagtggaaaattccaacgga
atgaaacccttccgcccagatttattcttggaaacagcagaggaaaaagagctagaagtg
tacctacttgtaaaaaactgttgggaggaagatccagaaaagagaccagatttcaaaaaa
attgagactacacttgccaagatatttggactttttcatgaccaaaaaaatgaaagctat
atggataccttgatccgacgtctacagctatattctcgaaacctggaacatctggtagag
gaaaggacacaactgtacaaggcagagagggacagggctgacagacttaactttatgttg
cttccaaggctagtggtaaagtctctgaaggagaaaggctttgtggagccggaactgtat
gaggaagttacaatctacttcagtgacattgtaggtttcactactatctgcaaatacagc
acccccatggaagtggtggacatgcttaatgacatctataagagttttgaccacattgtt
gatcatcatgatgtctacaaggtggaaaccattggtgatgcctacatggtggctagtggt
ttgcctaagagaaatggcaatcggcatgcaatagacattgccaagatggccttggaaatc
ctcagcttcatggggacctttgagctggagcatcttcctggcctcccaatatggattcgc
attggagttcactctggtccctgtgctgctggagttgtgggaatcaagatgcctcgttat
tgtctatttggagatacggtcaacacagcctctaggatggaatccactggcctccctttg
agaattcacgtgagtggctccaccatagccatcctgaagagaactgagtgccagttcctc
tatgaagtgagaggagaaacatacttaaagggaagaggaaatgagactacctactggctg
accgggatgaaggaccagaaattcaacctgccaacccctcctactgtggagaatcaacag
cgtttgcaagcagaattttcagacatgattgccaactctttacagaaaagacaggcagca
gggataagaagccaaaagcccagacgggtagccagctataaaaaaggcactctggaatac
ttgcagctgaataccacagacaaggagagcacctatttttaa

DBGET integrated database retrieval system