KEGG   Pongo abelii (Sumatran orangutan): 100461146Help
Entry
100461146         CDS       T01416                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer's disease
pon05014  Amyotrophic lateral sclerosis (ALS)
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  HTLV-I infection
pon05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100461146 (PPP3R2)
   04310 Wnt signaling pathway
    100461146 (PPP3R2)
   04370 VEGF signaling pathway
    100461146 (PPP3R2)
   04020 Calcium signaling pathway
    100461146 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    100461146 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100461146 (PPP3R2)
   04218 Cellular senescence
    100461146 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100461146 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100461146 (PPP3R2)
   04660 T cell receptor signaling pathway
    100461146 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100461146 (PPP3R2)
   04659 Th17 cell differentiation
    100461146 (PPP3R2)
   04662 B cell receptor signaling pathway
    100461146 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    100461146 (PPP3R2)
   04921 Oxytocin signaling pathway
    100461146 (PPP3R2)
   04924 Renin secretion
    100461146 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    100461146 (PPP3R2)
   04720 Long-term potentiation
    100461146 (PPP3R2)
  Development
   04360 Axon guidance
    100461146 (PPP3R2)
   04380 Osteoclast differentiation
    100461146 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100461146 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    100461146 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    100461146 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    100461146 (PPP3R2)
   05166 HTLV-I infection
    100461146 (PPP3R2)
   05163 Human cytomegalovirus infection
    100461146 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100461146 (PPP3R2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100461146 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 100461146
NCBI-ProteinID: XP_009242979
Position
9
AA seq 173 aa AA seqDB search
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggaga
gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg
gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgagatttgcgttcagc
atttacgacatggataaagatggctatatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system