KEGG   Pongo abelii (Sumatran orangutan): 100461291Help
Entry
100461291         CDS       T01416                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04218  Cellular senescence
pon04350  TGF-beta signaling pathway
pon04380  Osteoclast differentiation
pon04390  Hippo signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05140  Leishmaniasis
pon05142  Chagas disease (American trypanosomiasis)
pon05144  Malaria
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05220  Chronic myeloid leukemia
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05321  Inflammatory bowel disease (IBD)
pon05323  Rheumatoid arthritis
pon05410  Hypertrophic cardiomyopathy (HCM)
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461291 (TGFB2)
   04350 TGF-beta signaling pathway
    100461291 (TGFB2)
   04390 Hippo signaling pathway
    100461291 (TGFB2)
   04068 FoxO signaling pathway
    100461291 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100461291 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100461291 (TGFB2)
   04218 Cellular senescence
    100461291 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100461291 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461291 (TGFB2)
   05206 MicroRNAs in cancer
    100461291 (TGFB2)
   05205 Proteoglycans in cancer
    100461291 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100461291 (TGFB2)
   05212 Pancreatic cancer
    100461291 (TGFB2)
   05225 Hepatocellular carcinoma
    100461291 (TGFB2)
   05226 Gastric cancer
    100461291 (TGFB2)
   05220 Chronic myeloid leukemia
    100461291 (TGFB2)
   05211 Renal cell carcinoma
    100461291 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100461291 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    100461291 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100461291 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    100461291 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100461291 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100461291 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461291 (TGFB2)
   05161 Hepatitis B
    100461291 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100461291 (TGFB2)
   05144 Malaria
    100461291 (TGFB2)
   05145 Toxoplasmosis
    100461291 (TGFB2)
   05140 Leishmaniasis
    100461291 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    100461291 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100461291 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100461291 (TGFB2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100461291 (TGFB2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100461291 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 100461291
NCBI-ProteinID: XP_002809490
Ensembl: ENSPPYG00000000213
UniProt: A0A2J8RS20
Position
1
AA seq 442 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLNSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaacagtcccccagaagactatcctgagcct
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccttacttcagaattgttcgattt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtgcctgaacaacggattgagctgtatcagattctc
aagtccaaagatttaacatctccaacccagcgctacattgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacttttgta
ccatctaataattacatcatcccaaataaaagcgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcggcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggaaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system